Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA116821_SDS_PAGE15.jpg SDS-PAGE

Thioredoxin domain-containing protein 12 Recombinant Protein | Txndc12 recombinant protein

Recombinant Mouse Thioredoxin domain-containing protein 12

Gene Names
Txndc12; ERp16; ERp19; 0610040B21Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Thioredoxin domain-containing protein 12; N/A; Recombinant Mouse Thioredoxin domain-containing protein 12; Endoplasmic reticulum resident protein 19; ER protein 19; ERp19; Thioredoxin-like protein p19; Txndc12 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-170aa; Full Length
Sequence
RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL
Sequence Length
170
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA116821_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Txndc12 recombinant protein
Possesses significant protein thiol-disulfide oxidase activity.
References
"ERp19 and ERp46, new members of the thioredoxin family of endoplasmic reticulum proteins." Knoblach B., Keller B.O., Groenendyk J., Aldred S., Zheng J., Lemire B.D., Li L., Michalak M. Mol. Cell. Proteomics 2:1104-1119(2003)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18.5 kDa
NCBI Official Full Name
thioredoxin domain-containing protein 12
NCBI Official Synonym Full Names
thioredoxin domain containing 12 (endoplasmic reticulum)
NCBI Official Symbol
Txndc12
NCBI Official Synonym Symbols
ERp16; ERp19; 0610040B21Rik
NCBI Protein Information
thioredoxin domain-containing protein 12
UniProt Protein Name
Thioredoxin domain-containing protein 12
UniProt Gene Name
Txndc12
UniProt Synonym Gene Names
Tlp19; ER protein 19; ERp19
UniProt Entry Name
TXD12_MOUSE

Similar Products

Product Notes

The Txndc12 txndc12 (Catalog #AAA116821) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-170aa; Full Length. The amino acid sequence is listed below: RTGLGKGFGD HIHWRTLEDG KKEAAASGLP LMVIIHKSWC GACKALKPKF AESTEISELS HNFVMVNLED EEEPRDEDFS PDGGYIPRIL FLDPSGKVRP EIINESGNPS YKYFYVSAEQ VVQGMKEAQE RLTGDAFREK HFQDEL. It is sometimes possible for the material contained within the vial of "Thioredoxin domain-containing protein 12, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.