IHC (Immunohiostchemistry)
(AAA330085 at 1/100 staining aaaaaa by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)
Mouse TLS/FUS Monoclonal Antibody | anti-TLS/FUS antibody
TLS/FUS Mouse Monoclonal Antibody
Reactivity
Human, MousePrediction: Dog, Chicken, Xenopus
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Affinity-chromatography.
Synonyms
TLS/FUS, Antibody; TLS/FUS Mouse Monoclonal Antibody; 75 kDa DNA pairing protein; 75 kDa DNA-pairing protein; ALS6; Amyotrophic lateral sclerosis 6; fus; FUS CHOP; Fus like protein; FUS_HUMAN; FUS1; Fused in sarcoma; Fusion (involved in t(12;16) in malignant liposarcoma); Fusion derived from t(12;16) malignant liposarcoma; Fusion gene in myxoid liposarcoma; Heterogeneous nuclear ribonucleoprotein P2; hnRNP P2; hnRNPP2; Oncogene FUS; Oncogene TLS; POMp75; RNA binding protein FUS; RNA-binding protein FUS; TLS; TLS CHOP; Translocated in liposarcoma; Translocated in liposarcoma protein; anti-TLS/FUS antibody
Host
Mouse
Reactivity
Human, Mouse
Prediction: Dog, Chicken, Xenopus
Prediction: Dog, Chicken, Xenopus
Clonality
Monoclonal
Isotype
Mouse IgG1
Specificity
TLS/FUS Antibody detects endogenous levels of total TLS/FUS.
Purity/Purification
Affinity-chromatography.
Form/Format
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Sequence
MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
Applicable Applications for anti-TLS/FUS antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthesized peptide derived from human TLS/FUS, corresponding to a region within C-terminal amino acids.
Conjugation
Unconjugated
Expression
Ubiquitous.
Preparation and Storage
Store at -20 degree C. Stable for 12 months from date of receipt.
IHC (Immunohiostchemistry)
(AAA330085 at 1/100 staining aaaaaa by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)
IHC (Immunohiostchemistry)
(AAA330085 at 1/100 staining aaaaaa by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)
WB (Western Blot)
(Western blot analysis of extracts from various samples, using TLS/FUS Antibody. Lane 1: HepG2 cells treated with blocking peptide, Lane 2: HepG2 cells, Lane 3: RAW264.7 cells.)
WB (Western Blot)
(Western blot analysis of extracts from various samples, using TLS/FUS Antibody. Lane 1: HepG2 cells treated with blocking peptide, Lane 2: HepG2 cells, Lane 3: RAW264.7 cells.)
Product Categories/Family for anti-TLS/FUS antibody
NCBI and Uniprot Product Information
Similar Products
Product Notes
The TLS/FUS (Catalog #AAA330085) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TLS/FUS Mouse Monoclonal Antibody reacts with Human, Mouse Prediction: Dog, Chicken, Xenopus and may cross-react with other species as described in the data sheet. AAA Biotech's TLS/FUS can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TLS/FUS for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASNDYTQQA TQSYGAYPTQ PGQGYSQQSS QPYGQQSYSG YSQSTDTSGY GQSSYSSYGQ SQNTGYGTQS TPQGYGSTGG YGSSQSSQSS YGQQSSYPGY GQQPAPSSTS GSYGSSSQSS SYGQPQSGSY SQQPSYGGQQ QSYGQQQSYN PPQGYGQQNQ YNSSSGGGGG GGGGGNYGQD QSSMSSGGGS GGGYGNQDQS GGGGSGGYGQ QDRGGRGRGG SGGGGGGGGG GYNRSSGGYE PRGRGGGRGG RGGMGGSDRG GFNKFGGPRD QGSRHDSEQD NSDNNTIFVQ GLGENVTIES VADYFKQIGI IKTNKKTGQP MINLYTDRET GKLKGEATVS FDDPPSAKAA IDWFDGKEFS GNPIKVSFAT RRADFNRGGG NGRGGRGRGG PMGRGGYGGG GSGGGGRGGF PSGGGGGGGQ QRAGDWKCPN PTCENMNFSW RNECNQCKAP KPDGPGGGPG GSHMGGNYGD DRRGGRGGYD RGGYRGRGGD RGGFRGGRGG GDRGGFGPGK MDSRGEHRQD RRERPY. It is sometimes possible for the material contained within the vial of "TLS/FUS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.