Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Mouse TOMM20 Monoclonal Antibody | anti-TOMM20 antibody

TOMM20 (Mitochondrial Import Receptor Subunit TOM20 Homolog, TOM20, Mitochondrial 20kD Outer Membrane Protein, Outer Mitochondrial Membrane Receptor Tom20, KIAA0016, MAS20, MOM19)

Gene Names
TOMM20; MAS20; MOM19; TOM20
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TOMM20, Antibody; TOMM20 (Mitochondrial Import Receptor Subunit TOM20 Homolog, TOM20, Mitochondrial 20kD Outer Membrane Protein, Outer Mitochondrial Membrane Receptor Tom20, KIAA0016, MAS20, MOM19); anti-TOMM20 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4F3
Specificity
Recognizes human TOMM20. Species Crossreactivity: mouse, rat
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
907
Applicable Applications for anti-TOMM20 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa1-145 of human TOMM20 (BC066335; AAH66335) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TOMM20 on HeLa cell. [antibody concentration 10ug/ml])

Application Data

(Detection limit for recombinant GST tagged TOMM20 is ~0.1ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase on formalin-fixed paraffin-embedded human small Intestine using 1346004 (3ug/ml).)

WB (Western Blot)

(Western Blot analysis in transfected 293T cell line using 134604. Lane 1: 134604 transfected lysate (16.3kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot analysis in NIH/3T3 using 134604.)

WB (Western Blot)

(Western Blot analysis of in PC-12 using 134604.)

WB (Western Blot)

(Western Blot analysis in HeLa using 134604.)

Product Categories/Family for anti-TOMM20 antibody
References
1. Cellular distribution and subcellular localization of spatacsin and spastizin, two proteins involved in hereditary spastic paraplegia. Murmu RP, Martin E, Rastetter A, Esteves T, Muriel MP, El Hachimi KH, Denora PS, Dauphin A, Fernandez JC, Duyckaerts C, Brice A, Darios F, Stevanin G.Mol Cell Neurosci. 2011 Apr 27.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens translocase of outer mitochondrial membrane 20 homolog (yeast), mRNA
NCBI Official Synonym Full Names
translocase of outer mitochondrial membrane 20
NCBI Official Symbol
TOMM20
NCBI Official Synonym Symbols
MAS20; MOM19; TOM20
NCBI Protein Information
mitochondrial import receptor subunit TOM20 homolog

Similar Products

Product Notes

The TOMM20 (Catalog #AAA24388) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TOMM20 (Mitochondrial Import Receptor Subunit TOM20 Homolog, TOM20, Mitochondrial 20kD Outer Membrane Protein, Outer Mitochondrial Membrane Receptor Tom20, KIAA0016, MAS20, MOM19) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TOMM20 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TOMM20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TOMM20, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.