Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA24055_WB7.jpg WB (Western Blot) (Western Blot analysis of TOMM22 expression in transfected 293T cell line by TOMM22 monoclonal antibody. Lane 1: TOMM22 transfected lysate (15.5kD). Lane 2: Non-transfected lysate.)

Mouse TOMM22 Monoclonal Antibody | anti-TOMM22 antibody

TOMM22 (Translocase of Outer Membrane 22 kDa Subunit Homolog, Mitochondrial Import Receptor Subunit TOM22 Homolog, TOM22, hTom22, 1C9-2, MST065, MSTP065)

Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
TOMM22, Antibody; TOMM22 (Translocase of Outer Membrane 22 kDa Subunit Homolog, Mitochondrial Import Receptor Subunit TOM22 Homolog, TOM22, hTom22, 1C9-2, MST065, MSTP065); Anti -TOMM22 (Translocase of Outer Membrane 22 kDa Subunit Homolog, Mitochondrial Import Receptor Subunit TOM22 Homolog, TOM22, hTom22, 1C9-2, MST065, MSTP065); anti-TOMM22 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G4
Specificity
Recognizes human TOMM22. Species Crossreactivity: mouse and rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
Applicable Applications for anti-TOMM22 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Full length recombinant corresponding to aa1-143 from human TOMM22 (AAH09363) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of TOMM22 expression in transfected 293T cell line by TOMM22 monoclonal antibody. Lane 1: TOMM22 transfected lysate (15.5kD). Lane 2: Non-transfected lysate.)

product-image-AAA24055_WB7.jpg WB (Western Blot) (Western Blot analysis of TOMM22 expression in transfected 293T cell line by TOMM22 monoclonal antibody. Lane 1: TOMM22 transfected lysate (15.5kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(TOMM22 monoclonal antibody. Western Blot analysis of TOMM22 expression in PC-12.)

product-image-AAA24055_WB6.jpg WB (Western Blot) (TOMM22 monoclonal antibody. Western Blot analysis of TOMM22 expression in PC-12.)

WB (Western Blot)

(Western blot analysis of TOMM22 over-expressed 293 cell line, cotransfected with TOMM22 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TOMM22 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA24055_WB5.jpg WB (Western Blot) (Western blot analysis of TOMM22 over-expressed 293 cell line, cotransfected with TOMM22 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TOMM22 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged TOMM22 is 0.1ng/ml as a capture antibody.)

product-image-AAA24055_APP4.jpg Application Data (Detection limit for recombinant GST tagged TOMM22 is 0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TOMM22 on HeLa cell. [antibody concentration 10ug/ml])

product-image-AAA24055_IF3.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TOMM22 on HeLa cell. [antibody concentration 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TOMM22 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)

product-image-AAA24055_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TOMM22 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot detection against Immunogen (41.73kD).)

product-image-AAA24055_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (41.73kD).)
Product Categories/Family for anti-TOMM22 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
translocase of outer mitochondrial membrane 22 homolog
NCBI Official Symbol
TOMM22
NCBI Protein Information
translocase of outer mitochondrial membrane 22 homolog; mitochondrial import receptor subunit TOM22 homolog

Similar Products

Product Notes

The TOMM22 (Catalog #AAA24055) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TOMM22 (Translocase of Outer Membrane 22 kDa Subunit Homolog, Mitochondrial Import Receptor Subunit TOM22 Homolog, TOM22, hTom22, 1C9-2, MST065, MSTP065) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TOMM22 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the TOMM22 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAAVAAAGA GEPQSPDELL PKGDAEKPEE ELEEDDDEEL DETLSERLWG LTEMFPERVR SAAGATFDLS LFVAQKMYRF SRAALWIGTT SFMILVLPVV FETEKLQMEQ QQQLQQRQIL LGPNTGLSGG MPGALPSLPG KI. It is sometimes possible for the material contained within the vial of "TOMM22, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.