Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26040_APP6.jpg Application Data (Detection limit for recombinant GST tagged TP53 is approximately 1ng/ml as a capture antibody.)

Mouse TP53 Monoclonal Antibody | anti-TP53 antibody

TP53 (Tumor Protein p53, FLJ92943, LFS1, TRP53, p53) (APC)

Gene Names
TP53; P53; BCC7; LFS1; BMFS5; TRP53
Applications
Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
TP53, Antibody; TP53 (Tumor Protein p53, FLJ92943, LFS1, TRP53, p53) (APC); Tumor Protein p53; FLJ92943; LFS1; TRP53; p53; anti-TP53 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C3
Specificity
Recognizes TP53.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
393
Applicable Applications for anti-TP53 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TP53 (AAH03596, 94aa-201aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged TP53 is approximately 1ng/ml as a capture antibody.)

product-image-AAA26040_APP6.jpg Application Data (Detection limit for recombinant GST tagged TP53 is approximately 1ng/ml as a capture antibody.)

WB (Western Blot)

(TP53 monoclonal antibody (M01), clone 2C3 Western Blot analysis of TP53 expression in A-431.)

product-image-AAA26040_WB5.jpg WB (Western Blot) (TP53 monoclonal antibody (M01), clone 2C3 Western Blot analysis of TP53 expression in A-431.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TP53 on A-431 cell. [antibody concentration 10 ug/ml])

product-image-AAA26040_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TP53 on A-431 cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TP53 on A-431 cell. [antibody concentration 10 ug/ml])

product-image-AAA26040_IF3.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TP53 on A-431 cell. [antibody concentration 10 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TP53 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])

product-image-AAA26040_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TP53 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to TP53 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])

product-image-AAA26040_APP.jpg Application Data (Immunoperoxidase of monoclonal antibody to TP53 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])
Related Product Information for anti-TP53 antibody
This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity. [provided by RefSeq]
Product Categories/Family for anti-TP53 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Tumor protein p53
NCBI Official Synonym Full Names
tumor protein p53
NCBI Official Symbol
TP53
NCBI Official Synonym Symbols
P53; BCC7; LFS1; BMFS5; TRP53
NCBI Protein Information
cellular tumor antigen p53

Similar Products

Product Notes

The TP53 (Catalog #AAA26040) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TP53 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TP53 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TP53, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.