Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282960_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Human placenta using Tryptophanyl-tRNA synthetase 1 Rabbit mAb (AAA282960) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

Rabbit anti-Human Tryptophanyl-tRNA synthetase 1 Monoclonal Antibody | anti-WARS1 antibody

Tryptophanyl-tRNA synthetase 1 Rabbit mAb

Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
Tryptophanyl-tRNA synthetase 1, Antibody; Tryptophanyl-tRNA synthetase 1 Rabbit mAb; HMN9; WARS; IFI53; IFP53; GAMMA-2; Tryptophanyl-tRNA synthetase 1; anti-WARS1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
VNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ
Applicable Applications for anti-WARS1 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 372-471 of human Tryptophanyl-tRNA synthetase 1 (P23381).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human placenta using Tryptophanyl-tRNA synthetase 1 Rabbit mAb (AAA282960) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA282960_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Human placenta using Tryptophanyl-tRNA synthetase 1 Rabbit mAb (AAA282960) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from U-937 cells using Tryptophanyl-tRNA synthetase 1 Rabbit mAb (AAA282960) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA282960_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from U-937 cells using Tryptophanyl-tRNA synthetase 1 Rabbit mAb (AAA282960) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-WARS1 antibody
Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene.
Product Categories/Family for anti-WARS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 53kDa
Observed MW: 53kDa
UniProt Protein Name
Tryptophan--tRNA ligase, cytoplasmic
UniProt Gene Name
WARS
UniProt Synonym Gene Names
IFI53; WRS; IFP53; TrpRS; hWRS
UniProt Entry Name
SYWC_HUMAN

Similar Products

Product Notes

The WARS1 wars (Catalog #AAA282960) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tryptophanyl-tRNA synthetase 1 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Tryptophanyl-tRNA synthetase 1 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the WARS1 wars for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VNKHAFSGGR DTIEEHRQFG GNCDVDVSFM YLTFFLEDDD KLEQIRKDYT SGAMLTGELK KALIEVLQPL IAEHQARRKE VTDEIVKEFM TPRKLSFDFQ. It is sometimes possible for the material contained within the vial of "Tryptophanyl-tRNA synthetase 1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.