Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26674_WB6.jpg WB (Western Blot) (TUBB2A monoclonal antibody (M04), clone 3B2. Western Blot analysis of TUBB2A expression in NIH/3T3.)

Mouse TUBB2A Monoclonal Antibody | anti-TUBB2A antibody

TUBB2A (Tubulin, beta 2A, TUBB, TUBB2, dJ40E16.7) (PE)

Average rating 0.0
No ratings yet
Gene Names
TUBB2A; TUBB; TUBB2; CDCBM5
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
TUBB2A, Antibody; TUBB2A (Tubulin, beta 2A, TUBB, TUBB2, dJ40E16.7) (PE); Tubulin; beta 2A; TUBB; TUBB2; dJ40E16.7; anti-TUBB2A antibody
Ordering
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B2
Specificity
Recognizes TUBB2A.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
445
Applicable Applications for anti-TUBB2A antibody
ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TUBB2A (AAH01194, 1aa-445aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNTNDLVSEYQQYQDATADEQGEFEEEEGEDEA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(TUBB2A monoclonal antibody (M04), clone 3B2. Western Blot analysis of TUBB2A expression in NIH/3T3.)

product-image-AAA26674_WB6.jpg WB (Western Blot) (TUBB2A monoclonal antibody (M04), clone 3B2. Western Blot analysis of TUBB2A expression in NIH/3T3.)

WB (Western Blot)

(TUBB2A monoclonal antibody (M04), clone 3B2. Western Blot analysis of TUBB2A expression in Jurkat.)

product-image-AAA26674_WB5.jpg WB (Western Blot) (TUBB2A monoclonal antibody (M04), clone 3B2. Western Blot analysis of TUBB2A expression in Jurkat.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TUBB2A on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml])

product-image-AAA26674_IHC4.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TUBB2A on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TUBB2A on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml])

product-image-AAA26674_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TUBB2A on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TUBB2A on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26674_IF2.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TUBB2A on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TUBB2A on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26674_IF.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TUBB2A on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-TUBB2A antibody
Mouse monoclonal antibody raised against a full-length recombinant TUBB2A.
Product Categories/Family for anti-TUBB2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Tubulin, beta 2A
NCBI Official Synonym Full Names
tubulin beta 2A class IIa
NCBI Official Symbol
TUBB2A
NCBI Official Synonym Symbols
TUBB; TUBB2; CDCBM5
NCBI Protein Information
tubulin beta-2A chain

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TUBB2A (Catalog #AAA26674) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TUBB2A can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TUBB2A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TUBB2A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.