Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26333_APP6.jpg Application Data (Detection limit for recombinant GST tagged TYK2 is approximately 1ng/ml as a capture antibody.)

Mouse TYK2 Monoclonal Antibody | anti-TYK2 antibody

TYK2 (Tyrosine Kinase 2, JTK1) (FITC)

Average rating 0.0
No ratings yet
Gene Names
TYK2; JTK1; IMD35
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
TYK2, Antibody; TYK2 (Tyrosine Kinase 2, JTK1) (FITC); Tyrosine Kinase 2; JTK1; anti-TYK2 antibody
Ordering
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6H1
Specificity
Recognizes TYK2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1187
Applicable Applications for anti-TYK2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TYK2 (AAH14243, 276aa-375aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAFGQPADRPREPLWA
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged TYK2 is approximately 1ng/ml as a capture antibody.)

product-image-AAA26333_APP6.jpg Application Data (Detection limit for recombinant GST tagged TYK2 is approximately 1ng/ml as a capture antibody.)

WB (Western Blot)

(TYK2 monoclonal antibody (M03), clone 6H1 Western Blot analysis of TYK2 expression in Hela S3 NE (Cat # L013V3).)

product-image-AAA26333_WB5.jpg WB (Western Blot) (TYK2 monoclonal antibody (M03), clone 6H1 Western Blot analysis of TYK2 expression in Hela S3 NE (Cat # L013V3).)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml])

product-image-AAA26333_IHC4.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml])

product-image-AAA26333_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

product-image-AAA26333_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

product-image-AAA26333_APP.jpg Application Data (Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])
Related Product Information for anti-TYK2 antibody
This gene encodes a member of the tyrosine kinase and, more specifically, the Janus kinases (JAKs) protein families. This protein associates with the cytoplasmic domain of type I and type II cytokine receptors and promulgate cytokine signals by phosphorylating receptor subunits. It is also component of both the type I and type III interferon signaling pathways. As such, it may play a role in anti-viral immunity. A mutation in this gene has been associated with hyperimmunoglobulin E syndrome (HIES) - a primary immunodeficiency characterized by elevated serum immunoglobulin E. [provided by RefSeq]
Product Categories/Family for anti-TYK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Tyrosine kinase 2
NCBI Official Synonym Full Names
tyrosine kinase 2
NCBI Official Symbol
TYK2
NCBI Official Synonym Symbols
JTK1; IMD35
NCBI Protein Information
non-receptor tyrosine-protein kinase TYK2

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TYK2 (Catalog #AAA26333) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TYK2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TYK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TYK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.