Rabbit anti-Human UGT1A1 Monoclonal Antibody | anti-UGT1A1 antibody

UGT1A1 Rabbit mAb

Cat. Num. AAA282993

• Reactivity: Human
• Applications: ELISA, Immunocytochemistry, Immunofluorescence
• Purity: Affinity purification
• Synonyms: UGT1A1, Antibody; UGT1A1 Rabbit mAb; GNT1; UGT1; UDPGT; UGT1A; HUG-BR1; BILIQTL1; UDPGT 1-1; UGT1A1; anti-UGT1A1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: FENDSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCSPIVAQYLSLPTVFFLHALPCSLEFEATQCPNPFSYVPRPLSSH

• Applicable Applications for anti-UGT1A1 antibody: ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence)
• Cross Reactivity: Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of humanUGT1A1 (NP_000454.1).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 cells using UGT1A1 Rabbit mAb (AAA282993) at dilution of 1 : 200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

ICC (Immunocytochemistry)

(Confocal imaging of NIH/3T3 cells using UGT1A1 Rabbit mAb (AAA282993, dilution 1:200) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (Blue). Objective: 60x.)

Related Product Information for anti-UGT1A1 antibody

This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids. Mutations in this gene result in Crigler-Najjar syndromes types I and II and in Gilbert syndrome.

Product Categories/Family for anti-UGT1A1 antibody

Signal Transduction; Endocrine Metabolism; Drug metabolism; Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 8850236
• NCBI GeneID: 54658
• NCBI Accession #: NP_000454.1
• NCBI GenBank Nucleotide #: NM_000463.2
• UniProt Accession #: P22309
• Molecular Weight: Calculated MW: 60kDa
• UniProt Protein Name: UDP-glucuronosyltransferase 1-1
• UniProt Gene Name: UGT1A1
• UniProt Synonym Gene Names: GNT1; UGT1; UDPGT 1-1; UGT1*1; UGT1-01; UGT1.1; hUG-BR1; UGT-1A; UGT1A
• UniProt Entry Name: UD11_HUMAN