<
IF (Immunofluorescence)
(Immunofluorescence analysis of NIH-3T3 cells using Versican Rabbit mAb (AAA282780) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
Rabbit anti-Human Versican Monoclonal Antibody | anti-VCAN antibody
Versican Rabbit mAb
Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
Versican, Antibody; Versican Rabbit mAb; WGN; ERVR; GHAP; PG-M; WGN1; CSPG2; Versican; anti-VCAN antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
QGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQRTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR
Applicable Applications for anti-VCAN antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 3200-3396 of human Versican (P13611).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of NIH-3T3 cells using Versican Rabbit mAb (AAA282780) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of NIH-3T3 cells using Versican Rabbit mAb (AAA282780) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Rat kidney using Versican Rabbit mAb (AAA282780) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Rat kidney using Versican Rabbit mAb (AAA282780) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Mouse brain using Versican Rabbit mAb (AAA282780) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Mouse brain using Versican Rabbit mAb (AAA282780) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using Versican Rabbit mAb (AAA282780) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using Versican Rabbit mAb (AAA282780) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of various lysates using Versican Rabbit mAb (AAA282780) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)
WB (Western Blot)
(Western blot analysis of various lysates using Versican Rabbit mAb (AAA282780) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)
Related Product Information for anti-VCAN antibody
This gene is a member of the aggrecan/versican proteoglycan family. The protein encoded is a large chondroitin sulfate proteoglycan and is a major component of the extracellular matrix. This protein is involved in cell adhesion, proliferation, proliferation, migration and angiogenesis and plays a central role in tissue morphogenesis and maintenance. Mutations in this gene are the cause of Wagner syndrome type 1. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-VCAN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 373kDa
Observed MW: 265kDa
Observed MW: 265kDa
UniProt Protein Name
Versican core protein
UniProt Gene Name
VCAN
UniProt Synonym Gene Names
CSPG2; Chondroitin sulfate proteoglycan 2; GHAP
UniProt Entry Name
CSPG2_HUMAN
Similar Products
Product Notes
The VCAN vcan (Catalog #AAA282780) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Versican Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Versican can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the VCAN vcan for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QGAHLTSILS HEEQMFVNRV GHDYQWIGLN DKMFEHDFRW TDGSTLQYEN WRPNQPDSFF SAGEDCVVII WHENGQWNDV PCNYHLTYTC KKGTVACGQP PVVENAKTFG KMKPRYEINS LIRYHCKDGF IQRHLPTIRC LGNGRWAIPK ITCMNPSAYQ RTYSMKYFKN SSSAKDNSIN TSKHDHRWSR RWQESRR. It is sometimes possible for the material contained within the vial of "Versican, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.