IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human esophageal using von Willebrand factor (VWF) Rabbit mAb (AAA282638) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)
Rabbit anti-Human von Willebrand factor (VWF) Monoclonal Antibody | anti-VWF antibody
von Willebrand factor (VWF) Rabbit mAb
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
von Willebrand factor (VWF), Antibody; von Willebrand factor (VWF) Rabbit mAb; VWD; F8VWF; von Willebrand factor (VWF); anti-VWF antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
APACQVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPEDCPVCEVAGRRFASGKKVTLNPSDPEHCQICHCDVVNLTCEACQEPGGLVVPPTDAPVSPTTLYVEDISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFV
Applicable Applications for anti-VWF antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1150-1300 of human von Willebrand factor (VWF)(P04275).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human esophageal using von Willebrand factor (VWF) Rabbit mAb (AAA282638) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human esophageal using von Willebrand factor (VWF) Rabbit mAb (AAA282638) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of lysates from Mouse liver, using von Willebrand factor (VWF) Rabbit mAb (AAA282638) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
WB (Western Blot)
(Western blot analysis of lysates from Mouse liver, using von Willebrand factor (VWF) Rabbit mAb (AAA282638) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
Related Product Information for anti-VWF antibody
This gene encodes a glycoprotein involved in hemostasis. The encoded preproprotein is proteolytically processed following assembly into large multimeric complexes. These complexes function in the adhesion of platelets to sites of vascular injury and the transport of various proteins in the blood. Mutations in this gene result in von Willebrand disease, an inherited bleeding disorder. An unprocessed pseudogene has been found on chromosome 22.
Product Categories/Family for anti-VWF antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 309kDa
Observed MW: 309kDa
Observed MW: 309kDa
UniProt Protein Name
von Willebrand factor
UniProt Gene Name
VWF
UniProt Synonym Gene Names
F8VWF; vWF
UniProt Entry Name
VWF_HUMAN
Similar Products
Product Notes
The VWF vwf (Catalog #AAA282638) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The von Willebrand factor (VWF) Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's von Willebrand factor (VWF) can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the VWF vwf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: APACQVTCQH PEPLACPVQC VEGCHAHCPP GKILDELLQT CVDPEDCPVC EVAGRRFASG KKVTLNPSDP EHCQICHCDV VNLTCEACQE PGGLVVPPTD APVSPTTLYV EDISEPPLHD FYCSRLLDLV FLLDGSSRLS EAEFEVLKAF V. It is sometimes possible for the material contained within the vial of "von Willebrand factor (VWF), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.