Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24100_WB7.jpg WB (Western Blot) (ZNF622 monoclonal antibody. Western Blot analysis of ZNF622 expression in Raw 264.7.)

Mouse ZNF622 Monoclonal Antibody | anti-ZNF622 antibody

ZNF622 (Zinc Finger Protein 622, Zinc Finger-like Protein 9, ZPR9)

Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ZNF622, Antibody; ZNF622 (Zinc Finger Protein 622, Zinc Finger-like Protein 9, ZPR9); Anti -ZNF622 (Zinc Finger Protein 622, Zinc Finger-like Protein 9, ZPR9); anti-ZNF622 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C5
Specificity
Recognizes human ZNF622. Species Crossreactivity: mouse and rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQ
Applicable Applications for anti-ZNF622 antibody
ELISA, WB (Western Blot), IF (Immunofluorescence)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa1-101 from human ZNF622 (NP_219482) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(ZNF622 monoclonal antibody. Western Blot analysis of ZNF622 expression in Raw 264.7.)

product-image-AAA24100_WB7.jpg WB (Western Blot) (ZNF622 monoclonal antibody. Western Blot analysis of ZNF622 expression in Raw 264.7.)

WB (Western Blot)

(ZNF622 monoclonal antibody. Western Blot analysis of ZNF622 expression in Hela NE.)

product-image-AAA24100_WB6.jpg WB (Western Blot) (ZNF622 monoclonal antibody. Western Blot analysis of ZNF622 expression in Hela NE.)

Application Data

(Detection limit for recombinant GST tagged ZNF622 is ~0.03ng/ml as a capture antibody.)

product-image-AAA24100_APP5.jpg Application Data (Detection limit for recombinant GST tagged ZNF622 is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to ZNF622 on HeLa cell. [antibody concentration 10ug/ml].)

product-image-AAA24100_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to ZNF622 on HeLa cell. [antibody concentration 10ug/ml].)

WB (Western Blot)

(Western Blot analysis of ZNF622 expression in transfected 293T cell line by ZNF622 monoclonal antibody.Lane 1: ZNF622 transfected lysate (54.3kD).Lane 2: Non-transfected lysate.)

product-image-AAA24100_WB3.jpg WB (Western Blot) (Western Blot analysis of ZNF622 expression in transfected 293T cell line by ZNF622 monoclonal antibody.Lane 1: ZNF622 transfected lysate (54.3kD).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(ZNF622 monoclonal antibody. Western Blot analysis of ZNF622 expression in PC-12.)

product-image-AAA24100_WB2.jpg WB (Western Blot) (ZNF622 monoclonal antibody. Western Blot analysis of ZNF622 expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

product-image-AAA24100_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)
Product Categories/Family for anti-ZNF622 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
zinc finger protein 622
NCBI Official Synonym Full Names
zinc finger protein 622<
NCBI Official Symbol
ZNF622
NCBI Protein Information
zinc finger protein 622

Similar Products

Product Notes

The ZNF622 (Catalog #AAA24100) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF622 (Zinc Finger Protein 622, Zinc Finger-like Protein 9, ZPR9) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF622 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot), IF (Immunofluorescence). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the ZNF622 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MATYTCITCR VAFRDADMQR AHYKTDWHRY NLRRKVASMA PVTAEGFQER VRAQRAVAEE ESKGSATYCT VCSKKFASFN AYENHLKSRR HVELEKKAVQ. It is sometimes possible for the material contained within the vial of "ZNF622, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.