SDS-PAGE
Periplasmic murein peptide-binding protein (mppA) Recombinant Protein | mppA recombinant protein
Recombinant Escherichia coli Periplasmic murein peptide-binding protein (mppA)
Gene Names
mppA; ECK1326; JW1322; ynaH
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Periplasmic murein peptide-binding protein (mppA); N/A; Recombinant Escherichia coli Periplasmic murein peptide-binding protein (mppA); Periplasmic murein peptide-binding protein; mppA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-537aa; Full Length of Mature Protein
Sequence
AEVPSGTVLAEKQELVRHIKDEPASLDPAKAVGLPEIQVIRDLFEGLVNQNEKGEIVPGVATQWKSNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQRLVDPKTLSPFAWFAALAGINNAQAIIDGKATPDQLGVTAVDAHTLKIQLDKPLPWFVNLTANFAFFPVQKANVESGKEWTKPGNLIGNGAYVLKERVVNEKLVVVPNTHYWDNAKTVLQKVTFLPINQESAATKRYLAGDIDITESFPKNMYQKLLKDIPGQVYTPPQLGTYYYAFNTQKGPTADQRVRLALSMTIDRRLMTEKVLGTGEKPAWHFTPDVTAGFTPEPSPFEQMSQEELNAQAKTLLSAAGYGPQKPLKLTLLYNTSENHQKIAIAVASMWKKNLGVDVKLQNQEWKTYIDSRNTGNFDVIRASWVGDYNEPSTFLTLLTSTHSGNISRFNNPAYDKVLAQASTENTVKARNADYNAAEKILMEQAPIAPIYQYTNGRLIKPWLKGYPINNPEDVAYSRTMYIVKH
Sequence Length
515
Species
Escherichia coli (strain K12)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for mppA recombinant protein
Essential for the uptake of the murein peptide L-alanyl-gamma-D-glutamyl-meso-diaminopimelate. Also transports some alpha-linked peptides such as Pro-Phe-Lys with low affinity. The transport is effected by the oligopeptide permease system.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73.6 kDa
NCBI Official Full Name
murein tripeptide (L-ala-gamma-D-glutamyl-meso-DAP) transporter subunit
NCBI Official Symbol
mppA
NCBI Official Synonym Symbols
ECK1326; JW1322; ynaH
NCBI Protein Information
murein tripeptide (L-ala-gamma-D-glutamyl-meso-DAP) transporter subunit
UniProt Protein Name
Periplasmic murein peptide-binding protein
UniProt Gene Name
mppA
UniProt Synonym Gene Names
ynaH
UniProt Entry Name
MPPA_ECOLI
Similar Products
Product Notes
The mppA mppa (Catalog #AAA115508) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-537aa; Full Length of Mature Protein. The amino acid sequence is listed below: AEVPSGTVLA EKQELVRHIK DEPASLDPAK AVGLPEIQVI RDLFEGLVNQ NEKGEIVPGV ATQWKSNDNR IWTFTLRDNA KWADGTPVTA QDFVYSWQRL VDPKTLSPFA WFAALAGINN AQAIIDGKAT PDQLGVTAVD AHTLKIQLDK PLPWFVNLTA NFAFFPVQKA NVESGKEWTK PGNLIGNGAY VLKERVVNEK LVVVPNTHYW DNAKTVLQKV TFLPINQESA ATKRYLAGDI DITESFPKNM YQKLLKDIPG QVYTPPQLGT YYYAFNTQKG PTADQRVRLA LSMTIDRRLM TEKVLGTGEK PAWHFTPDVT AGFTPEPSPF EQMSQEELNA QAKTLLSAAG YGPQKPLKLT LLYNTSENHQ KIAIAVASMW KKNLGVDVKL QNQEWKTYID SRNTGNFDVI RASWVGDYNE PSTFLTLLTS THSGNISRFN NPAYDKVLAQ ASTENTVKAR NADYNAAEKI LMEQAPIAPI YQYTNGRLIK PWLKGYPINN PEDVAYSRTM YIVKH. It is sometimes possible for the material contained within the vial of "Periplasmic murein peptide-binding protein (mppA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.