Myelin protein zero-like protein 1 (MPZL1) Recombinant Protein | MPZL1 recombinant protein
Recombinant Human Myelin protein zero-like protein 1 (MPZL1)
Gene Names
MPZL1; PZR; PZRa; PZRb; PZR1b; MPZL1b
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Myelin protein zero-like protein 1 (MPZL1); N/A; Recombinant Human Myelin protein zero-like protein 1 (MPZL1); MPZL1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
36-269aa. Full Length of Mature Protein
Sequence
SALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for MPZL1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for MPZL1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
12,354 Da
NCBI Official Full Name
myelin protein zero-like protein 1 isoform c
NCBI Official Synonym Full Names
myelin protein zero like 1
NCBI Official Symbol
MPZL1
NCBI Official Synonym Symbols
PZR; PZRa; PZRb; PZR1b; MPZL1b
NCBI Protein Information
myelin protein zero-like protein 1
UniProt Protein Name
Myelin protein zero-like protein 1
UniProt Gene Name
MPZL1
UniProt Synonym Gene Names
PZR
UniProt Entry Name
MPZL1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The MPZL1 mpzl1 (Catalog #AAA230852) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 36-269aa. Full Length of Mature Protein. The amino acid sequence is listed below: SALEVYTPKE IFVANGTQGK LTCKFKSTST TGGLTSVSWS FQPEGADTTV SFFHYSQGQV YLGNYPPFKD RISWAGDLDK KDASINIENM QFIHNGTYIC DVKNPPDIVV QPGHIRLYVV EKENLPVFPV WVVVGIVTAV VLGLTLLISM ILAVLYRRKN SKRDYTGCST SESLSPVKQA PRKSPSDTEG LVKSLPSGSH QGPVIYAQLD HSGGHHSDKI NKSESVVYAD IRKN. It is sometimes possible for the material contained within the vial of "Myelin protein zero-like protein 1 (MPZL1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.