Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Penicillin-binding protein 1B (mrcB) Recombinant Protein | mrcB recombinant protein

Recombinant Haemophilus influenzae Penicillin-binding protein 1B (mrcB), partial

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Penicillin-binding protein 1B (mrcB); N/A; Recombinant Haemophilus influenzae Penicillin-binding protein 1B (mrcB), partial; mrcB recombinant protein
Ordering
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Sequence
SQLQLKMKNPHLEGAMIITDYRTGEIRAVVGGLQTQYAGFNRALMAKRQIGSLVKPSIYLTALSNPEQFRLNTPINNQPITINVKGSPPWQPRNYDKKYSDSVMLMDALARSLNIPTVNIGMKVGLSKVIDTQKAMGWDNVEIPKVPAMLLGSYTISPYDVTKLYQTLANQGGRIALTTVDSIADRQGNLIFQHDKSAKQVVPQEAAFQTLFAMQQTVERGTARSLQKDYADLHLAGKTGTTNESRDTWFVGIDGKNISTVWLGRDDNGETKLTGASGALQIYKDYLN
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88,257 Da
NCBI Official Full Name
penicillin-binding protein 1B
NCBI Official Symbol
ponB
NCBI Protein Information
penicillin-binding protein 1B
UniProt Protein Name
Penicillin-binding protein 1B
UniProt Gene Name
mrcB
UniProt Synonym Gene Names
ponB; PBP-1b; PBP1b

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The mrcB mrcb (Catalog #AAA115145) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SQLQLKMKNP HLEGAMIITD YRTGEIRAVV GGLQTQYAGF NRALMAKRQI GSLVKPSIYL TALSNPEQFR LNTPINNQPI TINVKGSPPW QPRNYDKKYS DSVMLMDALA RSLNIPTVNI GMKVGLSKVI DTQKAMGWDN VEIPKVPAML LGSYTISPYD VTKLYQTLAN QGGRIALTTV DSIADRQGNL IFQHDKSAKQ VVPQEAAFQT LFAMQQTVER GTARSLQKDY ADLHLAGKTG TTNESRDTWF VGIDGKNIST VWLGRDDNGE TKLTGASGAL QIYKDYLN. It is sometimes possible for the material contained within the vial of "Penicillin-binding protein 1B (mrcB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.