Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA115226_SDS_PAGE15.jpg SDS-PAGE

Major royal jelly protein 1 Recombinant Protein | MRJP1 recombinant protein

Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1)

Gene Names
Mrjp1; GB14888; p56kP-4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Major royal jelly protein 1; N/A; Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1); 56-kDa protein 4; p56kP-4; Bee-milk protein; Royalactin; MRJP1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-432aa; Full Length of Mature Protein
Sequence
NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCENPDNDRTPFKISIHL
Production Note
Special Offer: The Baculovirus, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Baculovirus, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Baculovirus, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Baculovirus, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA115226_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for MRJP1 recombinant protein
Major royal jelly protein 1: induces the differentiation of honeybee larvae into queens through an Egfr-mediated signaling pathway. Promotes body size increase by activating p70 S6 kinase, stimulates ovary development by augmenting the titer of vitellogenin (Vg) and juvenile hormone, and reduces developmental time by increasing the activity of mitogen-activated protein kinase and inducing the 20-hydroxyecdysone protein (20E). Most abundant protein found in the royal jelly which is the food of the queen honey bee larva. The royal jelly determines the development of the young larvae and is responsible for the high reproductive ability of the honeybee queen. Jellein-1: has antibacterial activity against the Gram-positive bacteria S. aureus 6535, S. saprophyticus and B. subtilis CCT2471, and the Gram-negative bacteria E Coli CCT1371, E. cloacae 23355, K. pneumoniae 13883 and P. aeruginosa 27853, and antifungal activity against C. albicans. Lack cytolytic activity and does not induce rat peritoneal mast cell degranulation. Jellein-2: has antibacterial activity against the Gram-positive bacteria S. aureus 6535, S. saprophyticus and B. subtilis CCT2471, and the Gram-negative bacteria E Coli CCT1371, E. cloacae 23355, K. pneumoniae 13883 and P. aeruginosa 27853, and antifungal activity against C. albicans. Lack cytolytic activity and does not induce rat peritoneal mast cell degranulation. Jellein-4: lacks antibacterial and antifungal activity. Lacks cytolytic activity and does not induce rat peritoneal mast cell degranulation.
References
Change in the mode of gene expression of the hypopharyngeal gland cells with an age-dependent role change of the worker honeybee Apis mellifera L.Ohashi K., Natori S., Kubo T.Eur. J. Biochem. 249:797-802(1997) A hypopharyngeal gland protein of the worker honeybee Apis mellifera L. enhances proliferation of primary-cultured rat hepatocytes and suppresses apoptosis in the absence of serum.Kamakura M., Sakaki T.Protein Expr. Purif. 45:307-314(2006) Royalactin induces queen differentiation in honeybees.Kamakura M.Nature 473:478-483(2011)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48.9 kDa
NCBI Official Full Name
major royal jelly protein 1
NCBI Official Symbol
Mrjp1
NCBI Official Synonym Symbols
GB14888; p56kP-4
NCBI Protein Information
major royal jelly protein 1
UniProt Protein Name
Major royal jelly protein 1
UniProt Gene Name
MRJP1
UniProt Synonym Gene Names
MRJP-1; p56kP-4
UniProt Entry Name
MRJP1_APIME

Similar Products

Product Notes

The MRJP1 mrjp1 (Catalog #AAA115226) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-432aa; Full Length of Mature Protein. The amino acid sequence is listed below: NILRGESLNK SLPILHEWKF FDYDFGSDER RQDAILSGEY DYKNNYPSDI DQWHDKIFVT MLRYNGVPSS LNVISKKVGD GGPLLQPYPD WSFAKYDDCS GIVSASKLAI DKCDRLWVLD SGLVNNTQPM CSPKLLTFDL TTSQLLKQVE IPHDVAVNAT TGKGRLSSLA VQSLDCNTNS DTMVYIADEK GEGLIVYHNS DDSFHRLTSN TFDYDPKFTK MTIDGESYTA QDGISGMALS PMTNNLYYSP VASTSLYYVN TEQFRTSDYQ QNDIHYEGVQ NILDTQSSAK VVSKSGVLFF GLVGDSALGC WNEHRTLERH NIRTVAQSDE TLQMIASMKI KEALPHVPIF DRYINREYIL VLSNKMQKMV NNDFNFDDVN FRIMNANVNE LILNTRCENP DNDRTPFKIS IHL. It is sometimes possible for the material contained within the vial of "Major royal jelly protein 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.