Major royal jelly protein 1 Recombinant Protein | MRJP1 recombinant protein

Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1)

Cat. Num. AAA115226

• Gene Names: Mrjp1; GB14888; p56kP-4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Major royal jelly protein 1; N/A; Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1); 56-kDa protein 4; p56kP-4; Bee-milk protein; Royalactin; MRJP1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 20-432aa; Full Length of Mature Protein
• Sequence: NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCENPDNDRTPFKISIHL

• Production Note: Special Offer: The Baculovirus, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Baculovirus, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Baculovirus, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Baculovirus, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for MRJP1 recombinant protein

Major royal jelly protein 1: induces the differentiation of honeybee larvae into queens through an Egfr-mediated signaling pathway. Promotes body size increase by activating p70 S6 kinase, stimulates ovary development by augmenting the titer of vitellogenin (Vg) and juvenile hormone, and reduces developmental time by increasing the activity of mitogen-activated protein kinase and inducing the 20-hydroxyecdysone protein (20E). Most abundant protein found in the royal jelly which is the food of the queen honey bee larva. The royal jelly determines the development of the young larvae and is responsible for the high reproductive ability of the honeybee queen. Jellein-1: has antibacterial activity against the Gram-positive bacteria S. aureus 6535, S. saprophyticus and B. subtilis CCT2471, and the Gram-negative bacteria E Coli CCT1371, E. cloacae 23355, K. pneumoniae 13883 and P. aeruginosa 27853, and antifungal activity against C. albicans. Lack cytolytic activity and does not induce rat peritoneal mast cell degranulation. Jellein-2: has antibacterial activity against the Gram-positive bacteria S. aureus 6535, S. saprophyticus and B. subtilis CCT2471, and the Gram-negative bacteria E Coli CCT1371, E. cloacae 23355, K. pneumoniae 13883 and P. aeruginosa 27853, and antifungal activity against C. albicans. Lack cytolytic activity and does not induce rat peritoneal mast cell degranulation. Jellein-4: lacks antibacterial and antifungal activity. Lacks cytolytic activity and does not induce rat peritoneal mast cell degranulation.

References

Change in the mode of gene expression of the hypopharyngeal gland cells with an age-dependent role change of the worker honeybee Apis mellifera L.Ohashi K., Natori S., Kubo T.Eur. J. Biochem. 249:797-802(1997) A hypopharyngeal gland protein of the worker honeybee Apis mellifera L. enhances proliferation of primary-cultured rat hepatocytes and suppresses apoptosis in the absence of serum.Kamakura M., Sakaki T.Protein Expr. Purif. 45:307-314(2006) Royalactin induces queen differentiation in honeybees.Kamakura M.Nature 473:478-483(2011)

NCBI and Uniprot Product Information

• NCBI GI #: 58585098
• NCBI GeneID: 406090
• NCBI Accession #: NP_001011579.1
• NCBI GenBank Nucleotide #: NM_001011579.1
• UniProt Accession #: O18330; Q548D6
• Molecular Weight: 48.9 kDa
• NCBI Official Full Name: major royal jelly protein 1
• NCBI Official Symbol: Mrjp1
• NCBI Official Synonym Symbols: GB14888; p56kP-4
• NCBI Protein Information: major royal jelly protein 1
• UniProt Protein Name: Major royal jelly protein 1
• UniProt Gene Name: MRJP1
• UniProt Synonym Gene Names: MRJP-1; p56kP-4
• UniProt Entry Name: MRJP1_APIME