Metallothionein-1G (MT1G) Recombinant Protein | MT1G recombinant protein
Recombinant Human Metallothionein-1G (MT1G), partial
Gene Names
MT1G; MT1; MT1K
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Metallothionein-1G (MT1G); N/A; Recombinant Human Metallothionein-1G (MT1G), partial; Metallothionein-1K; MT-1K; Metallothionein-IG; MT-IG; MT1G recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Liquid or Lyophilized powder
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8
Sequence Positions
1-59. Partial of Isoform 2
Sequence
MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSC
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for MT1G recombinant protein
Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Product Categories/Family for MT1G recombinant protein
References
Structure and expression of the human metallothionein-IG gene. Differential promoter activity of two linked metallothionein-I genes in response to heavy metals.Foster R., Jahroudi N., Varshney U., Gedamu L.J. Biol. Chem. 263:11528-11535(1988) Structure and expression of the human metallothionein genes.Gedamu L., Varshney U., Jahroudi N., Foster R., Shworak N.W.Experientia Suppl. 52:361-372(1987) Hunziker P.E.Submitted (NOV-1993) to UniProtKB Induction by zinc of specific metallothionein isoforms in human monocytes.Pauwels M., van Weyenbergh J., Soumillion A., Proost P., Ley M.Eur. J. Biochem. 220:105-110(1994)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32.9 kDa
NCBI Official Full Name
metallothionein-1G isoform 2
NCBI Official Synonym Full Names
metallothionein 1G
NCBI Official Symbol
MT1G
NCBI Official Synonym Symbols
MT1; MT1K
NCBI Protein Information
metallothionein-1G
UniProt Protein Name
Metallothionein-1G
UniProt Gene Name
MT1G
UniProt Synonym Gene Names
MT1K; MT1M; MT-1G; MT-1K; MT-IG
UniProt Entry Name
MT1G_HUMAN
Similar Products
Product Notes
The MT1G mt1g (Catalog #AAA116152) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-59. Partial of Isoform 2. The amino acid sequence is listed below: MDPNCSCAAG VSCTCASSCK CKECKCTSCK KSCCSCCPVG CAKCAQGCIC KGASEKCSC. It is sometimes possible for the material contained within the vial of "Metallothionein-1G (MT1G), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
