Mucin-2 (MUC2) Recombinant Protein | MUC2 recombinant protein

Recombinant Human Mucin-2 (MUC2), partial

Cat. Num. AAA18472

• Gene Names: MUC2; MLP; SMUC; MUC-2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Mucin-2 (MUC2); N/A; Recombinant Human Mucin-2 (MUC2), partial; Intestinal mucin-2; MUC2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 36-240aa; partial
• Sequence: VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for MUC2 recombinant protein

Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.

Product Categories/Family for MUC2 recombinant protein

Signal Transduction

References

Molecular cloning of human intestinal mucin (MUC2) cDNA. Identification of the amino terminus and overall sequence similarity to prepro-von Willebrand factor.Gum J.R. Jr., Hicks J.W., Toribara N.W., Siddiki B., Kim Y.S.J. Biol. Chem. 269:2440-2446(1994) The human MUC2 intestinal mucin has cysteine-rich subdomains located both upstream and downstream of its central repetitive region.Gum J.R. Jr., Hicks J.W., Toribara N.W., Rothe E.-M., Lagace R.E., Kim Y.S.J. Biol. Chem. 267:21375-21383(1992) MUC-2 human small intestinal mucin gene structure. Repeated arrays and polymorphism.Toribara N.W., Gum J.R. Jr., Culhane P.J., Lagace R.E., Hicks J.W., Petersen G.M., Kim Y.S.J. Clin. Invest. 88:1005-1013(1991) Molecular cloning of human intestinal mucin cDNAs. Sequence analysis and evidence for genetic polymorphism.Gum J.R. Jr., Byrd J.C., Hicks J.W., Toribara N.W., Lamport D.T.A., Kim Y.S.J. Biol. Chem. 264:6480-6487(1989) Human intestinal mucin-like protein (MLP) is homologous with rat MLP in the C-terminal region, and is encoded by a gene on chromosome 11 p 15.5.Xu G., Huan L., Khatri I., Sajjan U.S., McCool D., Wang D., Jones C., Forstner G., Forstner J.Biochem. Biophys. Res. Commun. 183:821-828(1992) In vivo glycosylation of mucin tandem repeats.Silverman H.S., Parry S., Sutton-Smith M., Burdick M.D., McDermott K., Reid C.J., Batra S.K., Morris H.R., Hollingsworth M.A., Dell A., Harris A.Glycobiology 11:459-471(2001) The N terminus of the MUC2 mucin forms trimers that are held together within a trypsin-resistant core fragment.Godl K., Johansson M.E.V., Lidell M.E., Moergelin M., Karlsson H., Olson F.J., Gum J.R. Jr., Kim Y.S., Hansson G.C.J. Biol. Chem. 277:47248-47256(2002) An autocatalytic cleavage in the C terminus of the human MUC2 mucin occurs at the low pH of the late secretory pathway.Lidell M.E., Johansson M.E.V., Hansson G.C.J. Biol. Chem. 278:13944-13951(2003) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) The protein disulfide isomerase AGR2 is essential for production of intestinal mucus.Park S.-W., Zhen G., Verhaeghe C., Nakagami Y., Nguyenvu L.T., Barczak A.J., Killeen N., Erle D.J.Proc. Natl. Acad. Sci. U.S.A. 106:6950-6955(2009) Proteomic analyses of the two mucus layers of the colon barrier reveal that their main component, the Muc2 mucin, is strongly bound to the Fcgbp protein.Johansson M.E.V., Thomsson K.A., Hansson G.C.J. Proteome Res. 8:3549-3557(2009)

NCBI and Uniprot Product Information

• NCBI GI #: 557129045
• NCBI GeneID: 4583
• NCBI Accession #: NP_002448.3
• NCBI GenBank Nucleotide #: NM_002457.3
• UniProt Accession #: Q02817; Q14878
• Molecular Weight: 24.8 kDa
• NCBI Official Full Name: mucin-2
• NCBI Official Synonym Full Names: mucin 2, oligomeric mucus/gel-forming
• NCBI Official Symbol: MUC2
• NCBI Official Synonym Symbols: MLP; SMUC; MUC-2
• NCBI Protein Information: mucin-2
• UniProt Protein Name: Mucin-2
• UniProt Gene Name: MUC2
• UniProt Synonym Gene Names: SMUC; MUC-2
• UniProt Entry Name: MUC2_HUMAN