Application Data
Major urinary protein 6 (Mup6) Recombinant Protein | Mup6 recombinant protein
Recombinant Mouse Major urinary protein 6 (Mup6)
Gene Names
Mup19; Mup6; Mup8; Mup11; Mup14; Mup17; Gm12552; 100039247
Reactivity
Mouse
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Major urinary protein 6 (Mup6); N/A; Recombinant Mouse Major urinary protein 6 (Mup6); Alpha-2U-globulin, Group 1, BS6, Allergen: Mus m 1; Mup6 recombinant protein
Host
E Coli
Reactivity
Mouse
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer, 50% glycerol
Sequence
MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
Calculated MW
36.6 kDa
Immunogen Description
Expression Region: 19-180aa Sequence Info: Full length
Tag Info
N-terminal 6xHis-SUMO-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20° C/-80°C. The shelf life of lyophilized form is 12 months at -20 °C/-80°C.
Notes: Repeated freezing and thawing is not recommended.
Store working aliquots at 4°C for up to one week.
Generally, the shelf life of liquid form is 6 months at -20° C/-80°C. The shelf life of lyophilized form is 12 months at -20 °C/-80°C.
Notes: Repeated freezing and thawing is not recommended.
Store working aliquots at 4°C for up to one week.
Application Data
Application Data
Related Product Information for Mup6 recombinant protein
Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
major urinary protein 11
NCBI Official Synonym Full Names
major urinary protein 19
NCBI Official Symbol
Mup19
NCBI Official Synonym Symbols
Mup6; Mup8; Mup11; Mup14; Mup17; Gm12552; 100039247
NCBI Protein Information
major urinary protein 11
UniProt Protein Name
Major urinary protein 6
UniProt Gene Name
Mup6
UniProt Synonym Gene Names
MUP 6
Similar Products
Product Notes
The Mup6 mup6 (Catalog #AAA309808) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Recombinant Mouse Major urinary protein 6 (Mup6) reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: MKMLLLLCLG LTLVCVHAEE ASSTGRNFNV EKINGEWHTI ILASDKREKI EDNGNFRLFL EQIHVLENSL VLKFHTVRDE ECSELSMVAD KTEKAGEYSV TYDGFNTFTI PKTDYDNFLM AHLINEKDGE TFQLMGLYGR EPDLSSDIKE RFAQLCEEHG ILRENIIDLS NANRCLQARE. It is sometimes possible for the material contained within the vial of "Major urinary protein 6 (Mup6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.