Mycobacterium Tuberculosis major secretory protein Antigen 85B Recombinant Protein | Ag85B recombinant protein
Recombinant Mycobacterium Tuberculosis major secretory protein Antigen 85B
Purity
Greater than 90.0% as determined by SDS-PAGE.
Synonyms
Mycobacterium Tuberculosis major secretory protein Antigen 85B; N/A; Recombinant Mycobacterium Tuberculosis major secretory protein Antigen 85B; Ag85B; Mycobacterium Tuberculosis major secretory protein Antigen 85B Recombinant; Antigen 85-B; 85B; Extracellular alpha-antigen; Antigen 85 complex B; Mycolyl transferase 85B; EC 2.3.1.-; Fibronectin-binding protein B; 30 kDa extracellular protein; fbpB; A85B; Major Secretory Protein Antigen 85B; Ag85B recombinant protein
Host
E Coli
Purity/Purification
Greater than 90.0% as determined by SDS-PAGE.
Form/Format
Lyophilized with no additives.
Physical Appearance: Sterile Filtered and lyophilized, though might appear as a solution as a result of the glycerol content.
Physical Appearance: Sterile Filtered and lyophilized, though might appear as a solution as a result of the glycerol content.
Sequence
MRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Solubility
It is recommended to reconstitute the lyophilized Antigen-85B in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Preparation and Storage
Ag85B although stable room temperature for 4 weeks, should be stored desiccated below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for Ag85B recombinant protein
Description: Ag85B Recombinant His-Tag fusion protein (1-325 a.a.) produced in E.coli is a single, non-glycosylated polypeptide chain having a molecular mass of 30kDa.
Product Categories/Family for Ag85B recombinant protein
NCBI and Uniprot Product Information
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Ag85B (Catalog #AAA38575) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MRGSHHHHHH FSRPGLPVEY LQVPSPSMGR DIKVQFQSGG NNSPAVYLLD GLRAQDDYNG WDINTPAFEW YYQSGLSIVM PVGGQSSFYS DWYSPACGKA GCQTYKWETF LTSELPQWLS ANRAVKPTGS AAIGLSMAGS SAMILAAYHP QQFIYAGSLS ALLDPSQGMG PSLIGLAMGD AGGYKAADMW GPSSDPAWER NDPTQQIPKL VANNTRLWVY CGNGTPNELG GANIPAEFLE NFVRSSNLKF QDAYNAAGGH NAVFNFPPNG THSWEYWGAQ LNAMKGDLQS SLGAG. It is sometimes possible for the material contained within the vial of "Mycobacterium Tuberculosis major secretory protein Antigen 85B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.