SDS-PAGE
NA recombinant protein
NA (A/Michigan/45/2015) (H1N1)
Applications
ELISA, Western Blot
Purity
>95% pure by 4-20% SDS PAGE gel
Synonyms
NA; N/A; NA (A/Michigan/45/2015) (H1N1); NA recombinant protein
Host
HEK-293 Cells
Purity/Purification
>95% pure by 4-20% SDS PAGE gel
Form/Format
In PBS
Concentration
1 ug/ul (varies by lot)
Sequence
IGNIISIWVSHSIQIGNQSQIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDV
FVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDSGAV
AVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTIMTDGPSDGQASYKIFRIEKGKIIKSVEMKAPNYHYEECSCYPDSSEITCVC
RDNWHGSNRPWVSFNQNLEYQMGYICSGVFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRKGFEMIWDPNGWT
GTDNKFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPEENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDKH
HHHHH
Applicable Applications for NA recombinant protein
ELISA, WB (Western Blot)
Tag
C-terminal 6xhis tagged
Preparation and Storage
Store at -20 degree C. Non-hazardous. No MSDS required.
SDS-PAGE
SDS-PAGE
Related Product Information for NA recombinant protein
Description: Viral protein expressed and purified from HEK-293 cells
Introduction: Influenza virus neuraminidase (NA) is a type of virus membrane surface neuraminidase that enables the virus to be released from the host cell. Neuraminidase enzymes are glycoside hydrolase enzymes that cleave sialic acid groups from glycoproteins and are required for influenza virus replication.
Viral Protein: Neuraminidase (aa 36-469)(A/Michigan/45/2015)(H1N1) (GenBank No. APC60200), having a molecular weight of 60-75 kDa.
Introduction: Influenza virus neuraminidase (NA) is a type of virus membrane surface neuraminidase that enables the virus to be released from the host cell. Neuraminidase enzymes are glycoside hydrolase enzymes that cleave sialic acid groups from glycoproteins and are required for influenza virus replication.
Viral Protein: Neuraminidase (aa 36-469)(A/Michigan/45/2015)(H1N1) (GenBank No. APC60200), having a molecular weight of 60-75 kDa.
Product Categories/Family for NA recombinant protein
Similar Products
Product Notes
The NA (Catalog #AAA62081) is a Recombinant Protein produced from HEK-293 Cells and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NA can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the NA for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IGNIISIWVS HSIQIGNQSQ IETCNQSVIT YENNTWVNQT YVNISNTNFA AGQSVVSVKL AGNSSLCPVS GWAIYSKDNS VRIGSKGDV FVIREPFISC SPLECRTFFL TQGALLNDKH SNGTIKDRSP YRTLMSCPIG EVPSPYNSRF ESVAWSASAC HDGINWLTIG ISGPDSGAV AVLKYNGIIT DTIKSWRNNI LRTQESECAC VNGSCFTIMT DGPSDGQASY KIFRIEKGKI IKSVEMKAPN YHYEECSCYP DSSEITCVC RDNWHGSNRP WVSFNQNLEY QMGYICSGVF GDNPRPNDKT GSCGPVSSNG ANGVKGFSFK YGNGVWIGRT KSISSRKGFE MIWDPNGWT GTDNKFSIKQ DIVGINEWSG YSGSFVQHPE LTGLDCIRPC FWVELIRGRP EENTIWTSGS SISFCGVNSD TVGWSWPDGA ELPFTIDKH HHHHH. It is sometimes possible for the material contained within the vial of "NA, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.