Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA117077_SDS_PAGE15.jpg SDS-PAGE

N-acetyl-D-glucosamine kinase Recombinant Protein | NAGK recombinant protein

Recombinant Human N-acetyl-D-glucosamine kinase

Gene Names
NAGK; GNK; HSA242910
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
N-acetyl-D-glucosamine kinase; N/A; Recombinant Human N-acetyl-D-glucosamine kinase; GlcNAc kinase; NAGK recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-344aa; Full Length
Sequence
AAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS
Sequence Length
344
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA117077_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for NAGK recombinant protein
Converts endogenous N-acetylglucosamine (GlcNAc), a major component of complex carbohydrates, from lysosomal degradation or nutritional sources into GlcNAc 6-phosphate. Involved in the N-glycolylneuraminic acid (Neu5Gc) degradation pathway: although human is not able to catalyze formation of Neu5Gc due to the inactive CMAHP enzyme, Neu5Gc is present in food and must be degraded. Also has ManNAc kinase activity.
Product Categories/Family for NAGK recombinant protein
References
Molecular cloning and characterization of murine and human N-acetylglucosamine kinase.Hinderlich S., Berger M., Schwarzkopf M., Effertz K., Reutter W.Eur. J. Biochem. 267:3301-3308(2000)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53.2 kDa
NCBI Official Full Name
N-acetyl-D-glucosamine kinase
NCBI Official Synonym Full Names
N-acetylglucosamine kinase
NCBI Official Symbol
NAGK
NCBI Official Synonym Symbols
GNK; HSA242910
NCBI Protein Information
N-acetyl-D-glucosamine kinase
UniProt Protein Name
N-acetyl-D-glucosamine kinase
UniProt Gene Name
NAGK
UniProt Synonym Gene Names
N-acetylglucosamine kinase
UniProt Entry Name
NAGK_HUMAN

Similar Products

Product Notes

The NAGK nagk (Catalog #AAA117077) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-344aa; Full Length. The amino acid sequence is listed below: AAIYGGVEGG GTRSEVLLVS EDGKILAEAD GLSTNHWLIG TDKCVERINE MVNRAKRKAG VDPLVPLRSL GLSLSGGDQE DAGRILIEEL RDRFPYLSES YLITTDAAGS IATATPDGGV VLISGTGSNC RLINPDGSES GCGGWGHMMG DEGSAYWIAH QAVKIVFDSI DNLEAAPHDI GYVKQAMFHY FQVPDRLGIL THLYRDFDKC RFAGFCRKIA EGAQQGDPLS RYIFRKAGEM LGRHIVAVLP EIDPVLFQGK IGLPILCVGS VWKSWELLKE GFLLALTQGR EIQAQNFFSS FTLMKLRHSS ALGGASLGAR HIGHLLPMDY SANAIAFYSY TFS. It is sometimes possible for the material contained within the vial of "N-acetyl-D-glucosamine kinase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.