Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA13751_SDS_PAGE.jpg SDS-PAGE (SDS-PAGE: purified HIV-1 gp120 (HXBc2) (Clade B) protein)

gp120 (HXBc2) (HIV-1/Clade B) Recombinant Protein | gp120 recombinant protein

gp120 (HXBc2) (HIV-1/Clade B) (aa 34-518)

Applications
Western Blot, ELISA
Purity
> 95% purity (SDS PAGE).
Synonyms
gp120 (HXBc2) (HIV-1/Clade B); N/A; gp120 (HXBc2) (HIV-1/Clade B) (aa 34-518); glycosylated recombinant protein; gp120 (HXBC2) (Clade B); gp120 (HXBc2) (HIV-1/Clade B) (aa 34-518), glycosylated recombinant protein; gp120 recombinant protein
Ordering
For Research Use Only!
Purity/Purification
> 95% purity (SDS PAGE).
Concentration
1 ug/ul in PBS (varies by lot)
Sequence
WVTVYYGVPVWKEAT TTL FCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMV EQMHEDIISLWDQSLKPC VKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCS FNI STSI RGKVQKEYAFFYKLDI I PIDNDTTSYKLTSCNTSVITQA CPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVS TQLLLNGSLAEEEVVI RSVNFTDNAKTI I VQLN TSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLREQFGNNKTII FKQSSGGDPEIVTH SFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGG NSNNESEI FRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKRAVGHHHHHH
Applicable Applications for gp120 recombinant protein
Western Blot (WB), ELISA (EIA), HIV-1 entry inhibition,etc.
Endotxin Level
<0.01 EU per 1 ug of the protein by LAL test.
Preparation and Storage
Long term storage at -20°C or -70°C ; Stable for 3 months from date of receipt when kept at 4°C.

SDS-PAGE

(SDS-PAGE: purified HIV-1 gp120 (HXBc2) (Clade B) protein)

product-image-AAA13751_SDS_PAGE.jpg SDS-PAGE (SDS-PAGE: purified HIV-1 gp120 (HXBc2) (Clade B) protein)
Related Product Information for gp120 recombinant protein
Introduction: Envelope glycoprotein GP120 (or gp120) is a glycoprotein exposed on the surface of the HIV envelope. The 120 in its name comes from its molecular weight of 120. Gp120 is essential for virus entry into cells as it plays a vital role in attachment to specific cell surface receptors. These receptors are DC-SIGN, Heparan Sulfate Proteoglycan and a specific interaction with the CD4 receptor, particularly on helper T-cells. Binding to CD4 induces the start of a cascade of conformational changes in gp120 and gp41 that lead to the fusion of the viral with the host cell membrane. Binding to CD4 is mainly electrostatic although there are van der Waals interactions and hydrogen bonds.
Product Categories/Family for gp120 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
Human immunodeficiency virus type 1 (HXB2), complete genome; HIV1/HTLV-III/LAV reference genome
UniProt Protein Name
Protein Nef
UniProt Gene Name
nef
UniProt Entry Name
NEF_HV1H2

Similar Products

Product Notes

The gp120 nef (Catalog #AAA13751) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's gp120 (HXBc2) (HIV-1/Clade B) can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), ELISA (EIA), HIV-1 entry inhibition,etc. Researchers should empirically determine the suitability of the gp120 nef for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: WVTVYYGVPV WKEAT TTL FCASDAKAYD TEVHNVWATH ACVPTDPNPQ EVVLVNVTEN FNMWKNDMV EQMHEDIISL WDQSLKPC VKLTPLCVSL KCTDLKNDTN TNSSSGRMIM EKGEIKNCS FNI STSI RGKVQKEYAF FYKLDI I PIDNDTTSYK LTSCNTSVIT QA CPKVSFEPIP IHYCAPAGFA ILKCNNKTFN GTGPCTNVST VQCTHGIRPV VS TQLLLNGSLA EEEVVI RSVNFTDNAK TI I VQLN TSVEINCTRP NNNTRKRIRI QRGPGRAFVT IGKIGNMRQA HCNISRAKWN NTLKQIASKL REQFGNNKTI I FKQSSGGDPE IVTH SFNCGGEFFY CNSTQLFNST WFNSTWSTEG SNNTEGSDTI TLPCRIKQII NMWQKVGKAM YAPPISGQIR CSSNITGLLL TRDGG NSNNESEI FRPGGGDMRD NWRSELYKYK VVKIEPLGVA PTKAKRRVVQ REKRAVGHHH HHH. It is sometimes possible for the material contained within the vial of "gp120 (HXBc2) (HIV-1/Clade B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.