Pro-Nerve Growth Factor Recombinant Protein | ProNGF recombinant protein
Recombinant Human Pro-Nerve Growth Factor
Gene Names
NGF; NGFB; HSAN5; Beta-NGF
Purity
Greater than 95.0% as determined by SDS-PAGE.
Synonyms
Pro-Nerve Growth Factor; N/A; Recombinant Human Pro-Nerve Growth Factor; ProNGF Human; Pro-Nerve Growth Factor Human Recombinant; Human Pro-NGF; ProNGF; NGFB; ProNGF recombinant protein
Host
E Coli
Purity/Purification
Greater than 95.0% as determined by SDS-PAGE.
Form/Format
ProNGF was lyophilized from a 0.2 uM filtered solution of 20mM PB and 250mM NaCl pH 7.2.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Sequence Length
241
Solubility
It is recommended to reconstitute the lyophilized ProNGF in 1xPBS to a concentration no less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Preparation and Storage
Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution ProNGF should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. Please prevent freeze-thaw cycles.
Related Product Information for ProNGF recombinant protein
Description: Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.Pro-Nerve Growth Factor Human Recombinant produced in E Coli is a non-glycosylated, polypeptide chain containing 224 amino acids and having a molecular mass of 50KDa.The Pro NGF is purified by proprietary chromatographic techniques.
Product Categories/Family for ProNGF recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
beta-nerve growth factor
NCBI Official Synonym Full Names
nerve growth factor (beta polypeptide)
NCBI Official Symbol
NGF
NCBI Official Synonym Symbols
NGFB; HSAN5; Beta-NGF
NCBI Protein Information
beta-nerve growth factor; nerve growth factor, beta subunit
UniProt Protein Name
Beta-nerve growth factor
UniProt Gene Name
NGF
UniProt Synonym Gene Names
NGFB; Beta-NGF
UniProt Entry Name
NGF_HUMAN
Similar Products
Product Notes
The ProNGF ngf (Catalog #AAA38201) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MEPHSESNVP AGHTIPQVHW TKLQHSLDTA LRRARSAPAA AIAARVAGQT RNITVDPRLF KKRRLRSPRV LFSTQPPREA ADTQDLDFEV GGAAPFNRTH RSKRSSSHPI FHRGEFSVCD SVSVWVGDKT TATDIKGKEV MVLGEVNINN SVFKQYFFET KCRDPNPVDS GCRGIDSKHW NSYCTTTHTF VKALTMDGKQ AAWRFIRIDT ACVCVLSRKA VRRA. It is sometimes possible for the material contained within the vial of "Pro-Nerve Growth Factor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.