Homeobox protein Nkx-2.2 Recombinant Protein | Nkx2-2 recombinant protein
Recombinant Mouse Homeobox protein Nkx-2.2
Gene Names
Nkx2-2; Nkx2.2; tinman; Nkx-2.2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Homeobox protein Nkx-2.2; N/A; Recombinant Mouse Homeobox protein Nkx-2.2; Homeobox protein NK-2 homolog B; Nkx2-2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-273aa; Full Length
Sequence
MSLTNTKTGFSVKDILDLPDTNDEDGSVAEGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLASTEGLQYSLHGLAASAPPQDSSSKSPEPSADESPDNDKETQGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
Sequence Length
273
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Nkx2-2 recombinant protein
Acts as a transcriptional activator. Required for the maintenance of NEUROD1 expression in the horomone-producing endocrine cells of the pancreas. May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Associates with chromatin at the NEUROD1 promoter region. Binds to a subset of consensus elements within the NEUROD1 promoter.
References
"Regional expression of the homeobox gene Nkx-2.2 in the developing mammalian forebrain." Price M., Lazzaro D., Pohl T., Mattei M.-G., Ruether U., Olivo J.-C., Duboule D., di Lauro R. Neuron 8:241-255(1992)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46.1 kDa
NCBI Official Full Name
homeobox protein Nkx-2.2 isoform 1
NCBI Official Synonym Full Names
NK2 homeobox 2
NCBI Official Symbol
Nkx2-2
NCBI Official Synonym Symbols
Nkx2.2; tinman; Nkx-2.2
NCBI Protein Information
homeobox protein Nkx-2.2
UniProt Protein Name
Homeobox protein Nkx-2.2
UniProt Gene Name
Nkx2-2
UniProt Synonym Gene Names
Nkx-2.2; Nkx2b
UniProt Entry Name
NKX22_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Nkx2-2 nkx2-2 (Catalog #AAA81679) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-273aa; Full Length. The amino acid sequence is listed below: MSLTNTKTGF SVKDILDLPD TNDEDGSVAE GPEEESEGPE PAKRAGPLGQ GALDAVQSLP LKSPFYDSSD NPYTRWLAST EGLQYSLHGL AASAPPQDSS SKSPEPSADE SPDNDKETQG GGGDAGKKRK RRVLFSKAQT YELERRFRQQ RYLSAPEREH LASLIRLTPT QVKIWFQNHR YKMKRARAEK GMEVTPLPSP RRVAVPVLVR DGKPCHALKA QDLAAATFQA GIPFSAYSAQ SLQHMQYNAQ YSSASTPQYP TAHPLVQAQQ WTW. It is sometimes possible for the material contained within the vial of "Homeobox protein Nkx-2.2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
