NADPH oxidase 4 Recombinant Protein | Nox4 recombinant protein
Recombinant Rat NADPH oxidase 4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
NADPH oxidase 4; N/A; Recombinant Rat NADPH oxidase 4; Kidney oxidase-1; KOX-1; Kidney superoxide-producing NADPH oxidase; Nox4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
210-424aa; partial
Sequence
GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Nox4 recombinant protein
Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB.
Product Categories/Family for Nox4 recombinant protein
References
Novel gp91(phox) homologues in vascular smooth muscle cells nox1 mediates angiotensin II-induced superoxide formation and redox-sensitive signaling pathways.Lassegue B., Sorescu D., Szoecs K., Yin Q., Akers M., Zhang Y., Grant S.L., Lambeth J.D., Griendling K.K.Circ. Res. 88:888-894(2001) A novel superoxide-producing NAD(P) H oxidase in kidney.Shiose A., Kuroda J., Tsuruya K., Hirai M., Hirakata H., Naito S., Hattori M., Sakaki Y., Sumimoto H.J. Biol. Chem. 276:1417-1423(2001) Distinct subcellular localizations of Nox1 and Nox4 in vascular smooth muscle cells.Hilenski L.L., Clempus R.E., Quinn M.T., Lambeth J.D., Griendling K.K.Arterioscler. Thromb. Vasc. Biol. 24:677-683(2004) Direct interaction of the novel Nox proteins with p22phox is required for the formation of a functionally active NADPH oxidase.Ambasta R.K., Kumar P., Griendling K.K., Schmidt H.H.H.W., Busse R., Brandes R.P.J. Biol. Chem. 279:45935-45941(2004) Nox4 NAD(P) H oxidase mediates hypertrophy and fibronectin expression in the diabetic kidney.Gorin Y., Block K., Hernandez J., Bhandari B., Wagner B., Barnes J.L., Abboud H.E.J. Biol. Chem. 280:39616-39626(2005) Regulation of NAD(P) H oxidase by associated protein disulfide isomerase in vascular smooth muscle cells.Janiszewski M., Lopes L.R., Carmo A.O., Pedro M.A., Brandes R.P., Santos C.X.C., Laurindo F.R.M.J. Biol. Chem. 280:40813-40819(2005)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38.6 kDa
NCBI Official Full Name
NADPH oxidase 4
NCBI Official Synonym Full Names
NADPH oxidase 4
NCBI Official Symbol
Nox4
NCBI Protein Information
NADPH oxidase 4
UniProt Protein Name
NADPH oxidase 4
UniProt Gene Name
Nox4
UniProt Synonym Gene Names
Kox; KOX-1
UniProt Entry Name
NOX4_RAT
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Nox4 nox4 (Catalog #AAA114256) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 210-424aa; partial. The amino acid sequence is listed below: GGLLKYQTNL DTHPPGCISL NRTPSQNMSI ADYVSEHFHG SLPGGFSKLE DHYQKTLVKI CLEEPKFQAH FPQTWIWISG PLCLYCAERL YRCIRSNKPV TIISVINHPS DVMELRMIKE NFKARPGQYI ILHCPSVSAL ENHPFTLTMC PTETKATFGV HFKVVGDWTE RFRDLLLPPS SQDSEILPFI QSRNYPKLYI DGPFGSPFEE SLNYE. It is sometimes possible for the material contained within the vial of "NADPH oxidase 4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
