Pro-neuregulin-2 Recombinant Protein | NRG2 recombinant protein
Recombinant Human Pro-neuregulin-2, membrane-bound isoform
Gene Names
NRG2; DON1; HRG2; NTAK
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pro-neuregulin-2; N/A; Recombinant Human Pro-neuregulin-2, membrane-bound isoform; Divergent of neuregulin-1; DON-1; Neural- and thymus-derived activator for ERBB kinases; NTAK; NRG2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
112-405. Partial, provide the Extracellular Domain
Sequence
CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKR
Sequence Length
405
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for NRG2 recombinant protein
Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.
Product Categories/Family for NRG2 recombinant protein
References
A novel brain-derived member of the epidermal growth factor family that interacts with ErbB3 and ErbB4.Higashiyama S., Horikawa M., Yamada K., Ichino N., Nakano N., Nakagawa T., Miyagawa J., Matsushita N., Nagatsu T., Taniguchi N., Ishiguro H.J. Biochem. 122:675-680(1997) Characterization of a neuregulin-related gene, Don-1, that is highly expressed in restricted regions of the cerebellum and hippocampus.Busfield S.J., Michnick D.A., Chickering T.W., Revett T.L., Ma J., Woolf E.A., Comrack C.A., Dussault B.J., Woolf J., Goodearl A.D.J., Gearing D.P.Mol. Cell. Biol. 17:4007-4014(1997) The human neuregulin 2 (NRG2) gene cloning, mapping and evaluation as a candidate for the autosomal recessive form of Charcot-Marie-Tooth disease linked to 5q.Ring H.Z., Chang H., Guilbot A., Brice A., LeGuern E., Francke U.Hum. Genet. 104:326-332(1999) Ligand discrimination in signaling through an ErbB4 receptor homodimer.Sweeney C., Lai C., Riese D.J. II, Diamonti A.J., Cantley L.C., Carraway K.L. IIIJ. Biol. Chem. 275:19803-19807(2000)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34.8 kDa
NCBI Official Full Name
pro-neuregulin-2, membrane-bound isoform isoform 7
NCBI Official Synonym Full Names
neuregulin 2
NCBI Official Symbol
NRG2
NCBI Official Synonym Symbols
DON1; HRG2; NTAK
NCBI Protein Information
pro-neuregulin-2, membrane-bound isoform
UniProt Protein Name
Pro-neuregulin-2, membrane-bound isoform
UniProt Gene Name
NRG2
UniProt Synonym Gene Names
NTAK; Pro-NRG2; NRG-2; DON-1; NTAK
UniProt Entry Name
NRG2_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The NRG2 nrg2 (Catalog #AAA115434) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 112-405. Partial, provide the Extracellular Domain. The amino acid sequence is listed below: CYSPSLKSVQ DQAYKAPVVV EGKVQGLVPA GGSSSNSTRE PPASGRVALV KVLDKWPLRS GGLQREQVIS VGSCVPLERN QRYIFFLEPT EQPLVFKTAF APLDTNGKNL KKEVGKILCT DCATRPKLKK MKSQTGQVGE KQSLKCEAAA GNPQPSYRWF KDGKELNRSR DIRIKYGNGR KNSRLQFNKV KVEDAGEYVC EAENILGKDT VRGRLYVNSV STTLSSWSGH ARKCNETAKS YCVNGGVCYY IEGINQLSCK CPNGFFGQRC LEKLPLRLYM PDPKQKAEEL YQKR. It is sometimes possible for the material contained within the vial of "Pro-neuregulin-2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
