UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit Recombinant Protein | OGT recombinant protein
Recombinant Human UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
Gene Names
OGT; HRNT1; HINCUT-1; O-GLCNAC
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit; N/A; Recombinant Human UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit; O-GlcNAc transferase subunit p110; O-linked N-acetylglucosamine transferase 110 kDa subunit; OGT; OGT recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
606-1022aa; partial
Sequence
MAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQ
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for OGT recombinant protein
Catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to a serine or threonine residue in cytoplasmic and nuclear proteins resulting in their modification with a beta-linked N-acetylglucosamine (O-GlcNAc). Glycosylates a large and diverse number of proteins including histone H2B, AKT1, EZH2, PFKL, KMT2E/MLL5, MAPT/TAU and HCFC1. Can regulate their cellular processes via cross-talk between glycosylation and phosphorylation or by affecting proteolytic processing. Involved in insulin resistance in muscle and adipocyte cells via glycosylating insulin signaling components and inhibiting the 'Thr-308' phosphorylation of AKT1, enhancing IRS1 phosphorylation and attenuating insulin signaling. Involved in glycolysis regulation by mediating glycosylation of 6-phosphofructokinase PFKL, inhibiting its activity. Component of a THAP1/THAP3-HCFC1-OGT complex that is required for the regulation of the transcriptional activity of RRM1. Plays a key role in chromatin structure by mediating O-GlcNAcylation of 'Ser-112' of histone H2B: recruited to CpG-rich transcription start sites of active genes via its interaction with TET proteins (TET1, TET2 or TET3). As part of the NSL complex indirectly involved in acetylation of nucleosomal histone H4 on several lysine residues. O-GlcNAcylation of 'Ser-75' of EZH2 increases its stability, and facilitating the formation of H3K27me3 by the PRC2/EED-EZH2 complex. Regulates circadian oscillation of the clock genes and glucose homeostasis in the liver. Stabilizes clock proteins ARNTL/BMAL1 and CLOCK through O-glycosylation, which prevents their ubiquitination and subsequent degradation. Promotes the CLOCK-ARNTL/BMAL1-mediated transcription of genes in the negative loop of the circadian clock such as PER1/2 and CRY1/2
Product Categories/Family for OGT recombinant protein
References
O-linked GlcNAc transferase is a conserved nucleocytoplasmic protein containing tetratricopeptide repeats.Lubas W.A., Frank D.W., Krause M., Hanover J.A.J. Biol. Chem. 272:9316-9324(1997) Human O-GlcNAc transferase (OGT) genomic structure, analysis of splice variants, fine mapping in Xq13.1.Nolte D., Muller U.Mamm. Genome 13:62-64(2002) The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007) Bienvenut W.V., Dhillon A.S., Kolch W.Submitted (FEB-2008) to UniProtKB Recruitment of O-GlcNAc transferase to promoters by corepressor mSin3A coupling protein O-GlcNAcylation to transcriptional repression.Yang X., Zhang F., Kudlow J.E.Cell 110:69-80(2002) Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1.Wysocka J., Myers M.P., Laherty C.D., Eisenman R.N., Herr W.Genes Dev. 17:896-911(2003) Phosphoinositide signalling links O-GlcNAc transferase to insulin resistance.Yang X., Ongusaha P.P., Miles P.D., Havstad J.C., Zhang F., So W.V., Kudlow J.E., Michell R.H., Olefsky J.M., Field S.J., Evans R.M.Nature 451:964-969(2008) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.Anal. Chem. 81:4493-4501(2009) Reduced O-GlcNAcylation links lower brain glucose metabolism and tau pathology in Alzheimer's disease.Liu F., Shi J., Tanimukai H., Gu J., Gu J., Grundke-Iqbal I., Iqbal K., Gong C.X.Brain 132:1820-1832(2009) Up-regulation of O-GlcNAc transferase with glucose deprivation in HepG2 cells is mediated by decreased hexosamine pathway flux.Taylor R.P., Geisler T.S., Chambers J.H., McClain D.A.J. Biol. Chem. 284:3425-3432(2009) GlcNAcylation of a histone methyltransferase in retinoic-acid-induced granulopoiesis.Fujiki R., Chikanishi T., Hashiba W., Ito H., Takada I., Roeder R.G., Kitagawa H., Kato S.Nature 459:455-459(2009) Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex.Cai Y., Jin J., Swanson S.K., Cole M.D., Choi S.H., Florens L., Washburn M.P., Conaway J.W., Conaway R.C.J. Biol. Chem. 285:4268-4272(2010) Regulation of insulin receptor substrate 1 (IRS-1) /AKT kinase-mediated insulin signaling by O-Linked beta-N-acetylglucosamine in 3T3-L1 adipocytes.Whelan S.A., Dias W.B., Thiruneelakantapillai L., Lane M.D., Hart G.W.J. Biol. Chem. 285:5204-5211(2010) The THAP-zinc finger protein THAP1 associates with coactivator HCF-1 and O-GlcNAc transferase a link between DYT6 and DYT3 dystonias.Mazars R., Gonzalez-de-Peredo A., Cayrol C., Lavigne A.C., Vogel J.L., Ortega N., Lacroix C., Gautier V., Huet G., Ray A., Monsarrat B., Kristie T.M., Girard J.P.J. Biol. Chem. 285:13364-13371(2010) Elevated O-GlcNAc-dependent signaling through inducible mOGT expression selectively triggers apoptosis.Shin S.H., Love D.C., Hanover J.A.Amino Acids 40:885-893(2011) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Crosstalk between O-GlcNAcylation and proteolytic cleavage regulates the host cell factor-1 maturation pathway.Daou S., Mashtalir N., Hammond-Martel I., Pak H., Yu H., Sui G., Vogel J.L., Kristie T.M., Affar E.B.Proc. Natl. Acad. Sci. U.S.A. 108:2747-2752(2011) GlcNAcylation of histone H2B facilitates its monoubiquitination.Fujiki R., Hashiba W., Sekine H., Yokoyama A., Chikanishi T., Ito S., Imai Y., Kim J., He H.H., Igarashi K., Kanno J., Ohtake F., Kitagawa H., Roeder R.G., Brown M., Kato S.Nature 480:557-560(2011) N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) Phosphofructokinase 1 glycosylation regulates cell growth and metabolism.Yi W., Clark P.M., Mason D.E., Keenan M.C., Hill C., Goddard W.A. III, Peters E.C., Driggers E.M., Hsieh-Wilson L.C.Science 337:975-980(2012) TET2 and TET3 regulate GlcNAcylation and H3K4 methylation through OGT and SET1/COMPASS.Deplus R., Delatte B., Schwinn M.K., Defrance M., Mendez J., Murphy N., Dawson M.A., Volkmar M., Putmans P., Calonne E., Shih A.H., Levine R.L., Bernard O., Mercher T., Solary E., Urh M., Daniels D.L., Fuks F.EMBO J. 32:645-655(2013) TET2 promotes histone O-GlcNAcylation during gene transcription.Chen Q., Chen Y., Bian C., Fujiki R., Yu X.Nature 493:561-564(2013) O-GlcNAcylation regulates EZH2 protein stability and function.Chu C.S., Lo P.W., Yeh Y.H., Hsu P.H., Peng S.H., Teng Y.C., Kang M.L., Wong C.H., Juan L.J.Proc. Natl. Acad. Sci. U.S.A. 111:1355-1360(2014) The superhelical TPR-repeat domain of O-linked GlcNAc transferase exhibits structural similarities to importin alpha.Jinek M., Rehwinkel J., Lazarus B.D., Izaurralde E., Hanover J.A., Conti E.Nat. Struct. Mol. Biol. 11:1001-1007(2004) Structure of human O-GlcNAc transferase and its complex with a peptide substrate.Lazarus M.B., Nam Y., Jiang J., Sliz P., Walker S.Nature 469:564-567(2011)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
62.5 kDa
NCBI Official Full Name
UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit isoform 1
NCBI Official Synonym Full Names
O-linked N-acetylglucosamine (GlcNAc) transferase
NCBI Official Symbol
OGT
NCBI Official Synonym Symbols
HRNT1; HINCUT-1; O-GLCNAC
NCBI Protein Information
UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
UniProt Protein Name
UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
UniProt Gene Name
OGT
UniProt Synonym Gene Names
OGT
UniProt Entry Name
OGT1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The OGT ogt (Catalog #AAA115161) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 606-1022aa; partial. The amino acid sequence is listed below: MAEANHFIDL SQIPCNGKAA DRIHQDGIHI LVNMNGYTKG ARNELFALRP APIQAMWLGY PGTSGALFMD YIITDQETSP AEVAEQYSEK LAYMPHTFFI GDHANMFPHL KKKAVIDFKS NGHIYDNRIV LNGIDLKAFL DSLPDVKIVK MKCPDGGDNA DSSNTALNMP VIPMNTIAEA VIEMINRGQI QITINGFSIS NGLATTQINN KAATGEEVPR TIIVTTRSQY GLPEDAIVYC NFNQLYKIDP STLQMWANIL KRVPNSVLWL LRFPAVGEPN IQQYAQNMGL PQNRIIFSPV APKEEHVRRG QLADVCLDTP LCNGHTTGMD VLWAGTPMVT MPGETLASRV AASQLTCLGC LELIAKNRQE YEDIAVKLGT DLEYLKKVRG KVWKQRISSP LFNTKQYTME LERLYLQ. It is sometimes possible for the material contained within the vial of "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
