Outer Membrane Protein A (ompA) Recombinant Protein | ompA recombinant protein
Recombinant Escherichia Coli Outer Membrane Protein A (ompA)
Gene Names
ompA; con; ECK0948; tolG; tut
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Outer Membrane Protein A (ompA); N/A; Recombinant Escherichia Coli Outer Membrane Protein A (ompA); Outer membrane protein II; con; tolG; tut; ompA recombinant protein
Host
In Vitro E Coli Expression System
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Tris-Based Buffer, 50% Glycerol
Sequence Positions
22-346aa; Full Length of Mature Protein
Sequence
APKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA
Species
Escherichia coli (strain K12)
Tag
N-terminal 10xHis-tagged
Subcellular Location
Cell Outer Membrane, Multi-Pass Membrane Protein
Protein Families
OmpA family
Production Note
Special Offer: The Cell Free host-expressed protein is manufactured from a stock plasmid containing the protein gene. Cell Freehost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Cell Free host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Cell Free host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ompA recombinant protein
Required for the action of colicins K and L and for the stabilization of mating aggregates in conjugation. Serves as a receptor for a number of T-even like phages. Also acts as a porin with low permeability that allows slow penetration of small solutes.
Product Categories/Family for ompA recombinant protein
References
"Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T. Mol. Syst. Biol. 2:E1-E5(2006).
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38.0 kDa
NCBI Official Full Name
outer membrane porin A
NCBI Official Symbol
ompA
NCBI Official Synonym Symbols
con; ECK0948; tolG; tut
NCBI Protein Information
outer membrane porin A
UniProt Protein Name
Outer membrane protein A
UniProt Gene Name
ompA
UniProt Synonym Gene Names
con; tolG; tut
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ompA ompa (Catalog #AAA235631) is a Recombinant Protein produced from In Vitro E Coli Expression System and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-346aa; Full Length of Mature Protein. The amino acid sequence is listed below: APKDNTWYTG AKLGWSQYHD TGFINNNGPT HENQLGAGAF GGYQVNPYVG FEMGYDWLGR MPYKGSVENG AYKAQGVQLT AKLGYPITDD LDIYTRLGGM VWRADTKSNV YGKNHDTGVS PVFAGGVEYA ITPEIATRLE YQWTNNIGDA HTIGTRPDNG MLSLGVSYRF GQGEAAPVVA PAPAPAPEVQ TKHFTLKSDV LFNFNKATLK PEGQAALDQL YSQLSNLDPK DGSVVVLGYT DRIGSDAYNQ GLSERRAQSV VDYLISKGIP ADKISARGMG ESNPVTGNTC DNVKQRAALI DCLAPDRRVE IEVKGIKDVV TQPQA. It is sometimes possible for the material contained within the vial of "Outer Membrane Protein A (ompA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.