Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Olfactory receptor 5V1 (OR5V1) Recombinant Protein | OR5V1 recombinant protein

Recombinant Human Olfactory receptor 5V1 (OR5V1)

Gene Names
OR5V1; 6M1-21; hs6M1-21
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Olfactory receptor 5V1 (OR5V1); N/A; Recombinant Human Olfactory receptor 5V1 (OR5V1); OR5V1 recombinant protein
Ordering
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-321. Full Length
Sequence
MERKNQTAITEFIILGFSNLNELQFLLFTIFFLTYFCTLGGNILIILTTVTDPHLHTPMYYFLGNLAFIDICYTTSNVPQMMVHLLSKKKSISYVGCVVQLFAFVFFVGSECLLLAAMAYDRYIAICNPLRYSVILSKVLCNQLAASCWAAGFLNSVVHTVLTFCLPFCGNNQINYFFCDIPPLLILSCGNTSVNELALLSTGVFIGWTPFLCIVLSYICIISTILRIQSSEGRRKAFSTCASHLAIVFLFYGSAIFTYVRPISTYSLKKDRLVSVLYSVVTPMLNPIIYTLRNKDIKEAVKTIGSKWQPPISSLDSKLTY
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for OR5V1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42.1 kDa
NCBI Official Full Name
olfactory receptor 5V1
NCBI Official Synonym Full Names
olfactory receptor family 5 subfamily V member 1
NCBI Official Symbol
OR5V1
NCBI Official Synonym Symbols
6M1-21; hs6M1-21
NCBI Protein Information
olfactory receptor 5V1
UniProt Protein Name
Olfactory receptor 5V1
UniProt Gene Name
OR5V1
UniProt Entry Name
OR5V1_HUMAN

Similar Products

Product Notes

The OR5V1 or5v1 (Catalog #AAA230719) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-321. Full Length. The amino acid sequence is listed below: MERKNQTAIT EFIILGFSNL NELQFLLFTI FFLTYFCTLG GNILIILTTV TDPHLHTPMY YFLGNLAFID ICYTTSNVPQ MMVHLLSKKK SISYVGCVVQ LFAFVFFVGS ECLLLAAMAY DRYIAICNPL RYSVILSKVL CNQLAASCWA AGFLNSVVHT VLTFCLPFCG NNQINYFFCD IPPLLILSCG NTSVNELALL STGVFIGWTP FLCIVLSYIC IISTILRIQS SEGRRKAFST CASHLAIVFL FYGSAIFTYV RPISTYSLKK DRLVSVLYSV VTPMLNPIIY TLRNKDIKEA VKTIGSKWQP PISSLDSKLT Y. It is sometimes possible for the material contained within the vial of "Olfactory receptor 5V1 (OR5V1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.