Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Oncostatin-M-specific receptor subunit beta (OSMR) Recombinant Protein | OSMR recombinant protein

Recombinant Human Oncostatin-M-specific receptor subunit beta (OSMR), partial

Average rating 0.0
No ratings yet
Gene Names
OSMR; OSMRB; PLCA1; IL-31RB; IL-31R-beta
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Oncostatin-M-specific receptor subunit beta (OSMR); N/A; Recombinant Human Oncostatin-M-specific receptor subunit beta (OSMR), partial; OSMR recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
762-979. Partial, provide the complete Cytoplasmic Domain.
Sequence
KSQWIKETCYPDIPDPYKSSILSLIKFKENPHLIIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLYLLPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVSPKAPSMLGLMTSPENVLKALEKNYMNSLGEIPAGETSLNYVSQLASPMFGDKDSLPTNPVEAPHCSEYKMQMAVSLRLALPPPTENSSLSSITLLDPGEHYC
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for OSMR recombinant protein
This gene encodes a member of the type I cytokine receptor family. The encoded protein heterodimerizes with interleukin 6 signal transducer to form the type II oncostatin M receptor and with interleukin 31 receptor A to form the interleukin 31 receptor, and thus transduces oncostatin M and interleukin 31 induced signaling events. Mutations in this gene have been associated with familial primary localized cutaneous amyloidosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,504 Da
NCBI Official Full Name
oncostatin-M-specific receptor subunit beta isoform 2
NCBI Official Synonym Full Names
oncostatin M receptor
NCBI Official Symbol
OSMR
NCBI Official Synonym Symbols
OSMRB; PLCA1; IL-31RB; IL-31R-beta
NCBI Protein Information
oncostatin-M-specific receptor subunit beta
UniProt Protein Name
Oncostatin-M-specific receptor subunit beta
UniProt Gene Name
OSMR
UniProt Synonym Gene Names
OSMRB; IL-31 receptor subunit beta; IL-31R subunit beta; IL-31R-beta; IL-31RB

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The OSMR osmr (Catalog #AAA116745) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 762-979. Partial, provide the complete Cytoplasmic Domain. The amino acid sequence is listed below: KSQWIKETCY PDIPDPYKSS ILSLIKFKEN PHLIIMNVSD CIPDAIEVVS KPEGTKIQFL GTRKSLTETE LTKPNYLYLL PTEKNHSGPG PCICFENLTY NQAASDSGSC GHVPVSPKAP SMLGLMTSPE NVLKALEKNY MNSLGEIPAG ETSLNYVSQL ASPMFGDKDS LPTNPVEAPH CSEYKMQMAV SLRLALPPPT ENSSLSSITL LDPGEHYC. It is sometimes possible for the material contained within the vial of "Oncostatin-M-specific receptor subunit beta (OSMR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.