Proline-rich P65 protein (p65) Recombinant Protein | p65 recombinant protein
Recombinant Mycoplasma pneumoniae Proline-rich P65 protein (p65)
Gene Names
P65; F10_orf405
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Proline-rich P65 protein (p65); N/A; Recombinant Mycoplasma pneumoniae Proline-rich P65 protein (p65); p65 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-405, Full length protein
Sequence
MDINKPGWNQSDQQATAYDPNQQQYYGDGSTYYDPDQAVDPNQAYYPDPNTYPDAAAYYGYGQDGQAYPQDYAQDPNQAYYADPNAYQDPNAYTDPNAYVDPNAYQDPNAYVDPNNYTDPNAYYGYGQDGQAYPQDYAQDPNQAYYADPNAYQDPNAYTDPYYVTSTDPNAYYGQVDNVPALEASDLAYEVTPQEQAAEQELFSEPETKVIREIHEFPFEKIRSYFQTDFDSYNSRLTQLKDKLDNAIFSMRKAIDTVKENSANLQIMKQNFERQLKEQQTQRLTSNTDAEKIGAKINQLEERMQRLSRTMESVEWTKKEPRQEQFDPRFVDPRNFNNYVNNTDTMMSMFEKVLMMNLLRSTTPVQPPVQYFTPQPLTASPRPVYEEPISASFRRRGYRGDEFYE
Sequence Length
405
Species
Mycoplasma pneumoniae (strain 29342 / M129)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47,040 Da
NCBI Official Full Name
hypothetical protein MPN309
NCBI Official Symbol
P65
NCBI Official Synonym Symbols
F10_orf405
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Proline-rich P65 protein
UniProt Gene Name
p65
Similar Products
Product Notes
The p65 p65 (Catalog #AAA115357) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-405, Full length protein. The amino acid sequence is listed below: MDINKPGWNQ SDQQATAYDP NQQQYYGDGS TYYDPDQAVD PNQAYYPDPN TYPDAAAYYG YGQDGQAYPQ DYAQDPNQAY YADPNAYQDP NAYTDPNAYV DPNAYQDPNA YVDPNNYTDP NAYYGYGQDG QAYPQDYAQD PNQAYYADPN AYQDPNAYTD PYYVTSTDPN AYYGQVDNVP ALEASDLAYE VTPQEQAAEQ ELFSEPETKV IREIHEFPFE KIRSYFQTDF DSYNSRLTQL KDKLDNAIFS MRKAIDTVKE NSANLQIMKQ NFERQLKEQQ TQRLTSNTDA EKIGAKINQL EERMQRLSRT MESVEWTKKE PRQEQFDPRF VDPRNFNNYV NNTDTMMSMF EKVLMMNLLR STTPVQPPVQ YFTPQPLTAS PRPVYEEPIS ASFRRRGYRG DEFYE. It is sometimes possible for the material contained within the vial of "Proline-rich P65 protein (p65), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.