Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 (PAG1) Recombinant Protein | PAG1 recombinant protein

Recombinant Human Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 (PAG1), partial

Gene Names
PAG1; CBP; PAG
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 (PAG1); N/A; Recombinant Human Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 (PAG1), partial; PAG1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
38-432aa; partial
Sequence
SSCDREKKPRQHSGDHENLMNVPSDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYATVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESISDLQQGRDITRL
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PAG1 recombinant protein
This protein is a type III transmembrane adaptor protein that binds to the tyrosine kinase csk protein. It is thought to be involved in the regulation of T cell activation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,981 Da
NCBI Official Full Name
phosphoprotein associated with glycosphingolipid-enriched microdomains 1
NCBI Official Synonym Full Names
phosphoprotein membrane anchor with glycosphingolipid microdomains 1
NCBI Official Symbol
PAG1
NCBI Official Synonym Symbols
CBP; PAG
NCBI Protein Information
phosphoprotein associated with glycosphingolipid-enriched microdomains 1
UniProt Protein Name
Phosphoprotein associated with glycosphingolipid-enriched microdomains 1
UniProt Gene Name
PAG1
UniProt Synonym Gene Names
CBP; PAG

Similar Products

Product Notes

The PAG1 pag1 (Catalog #AAA233608) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 38-432aa; partial. The amino acid sequence is listed below: SSCDREKKPR QHSGDHENLM NVPSDKEMFS RSVTSLATDA PASSEQNGAL TNGDILSEDS TLTCMQHYEE VQTSASDLLD SQDSTGKPKC HQSRELPRIP PESAVDTMLT ARSVDGDQGL GMEGPYEVLK DSSSQENMVE DCLYETVKEI KEVAAAAHLE KGHSGKAKST SASKELPGPQ TEGKAEFAEY ASVDRNKKCR QSVNVESILG NSCDPEEEAP PPVPVKLLDE NENLQEKEGG EAEESATDTT SETNKRFSSL SYKSREEDPT LTEEEISAMY SSVNKPGQLV NKSGQSLTVP ESTYTSIQGD PQRSPSSCND LYATVKDFEK TPNSTLPPAG RPSEEPEPDY EAIQTLNREE EKATLGTNGH HGLVPKENDY ESISDLQQGR DITRL. It is sometimes possible for the material contained within the vial of "Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 (PAG1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.