Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18557_SDS_PAGE.jpg SDS-PAGE

parvovirus B19 Capsid protein VP1 Recombinant Protein | VP2 recombinant protein

Recombinant Human parvovirus B19 Capsid protein VP1, partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
parvovirus B19 Capsid protein VP1; N/A; Recombinant Human parvovirus B19 Capsid protein VP1, partial; VP2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
228-781aa; partial
Sequence
MTSVNSAEASTGAGGGGSNSVKSMWSEGATFSANSVTCTFSRQFLIPYDPEHHYKVFSPAASSCHNASGKEAKVCTISPIMGYSTPWRYLDFNALNLFFSPLEFQHLIENYGSIAPDALTVTISEIAVKDVTDKTGGGVQVTDSTTGRLCMLVDHEYKYPYVLGQGQDTLAPELPIWVYFPPQYAYLTVGDVNTQGISGDSKKLASEESAFYVLEHSSFQLLGTGGTASMSYKFPPVPPENLEGCSQHFYEMYNPLYGSRLGVPDTLGGDPKFRSLTHEDHAIQPQNFMPGPLVNSVSTKEGDSSNTGAGKALTGLSTGTSQNTRISLRPGPVSQPYHHWDTDKYVTGINAISHGQTTYGNAEDKEYQQGVGRFPNEKEQLKQLQGLNMHTYFPNKGTQQYTDQIERPLMVGSVWNRRALHYESQLWSKIPNLDDSFKTQFAALGGWGLHQPPPQIFLKILPQSGPIGGIKSMGITTLVQYAVGIMTVTMTFKLGPRKATGRWNPQPGVYPPHAAGHLPYVLYDPTATDAKQHHRHGYEKPEELWTAKSRVHPL
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18557_SDS_PAGE.jpg SDS-PAGE
Related Product Information for VP2 recombinant protein
Capsid protein self-assbles to form an icosahedral capsid with a T=1 symmetry, about 22 nm in diameter, and consisting of 60 copies of two size variants of the capsid proteins, VP1 and VP2, which differ by the presence of an N-terminal extension in the minor protein VP1. The capsid encapsulates the genomic ssDNA. Capsid proteins are responsible for the attachment to host cell receptors, such as the glycosphingolipid globoside or the integrin heterodimer ITGAV/ITGB1. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. Binding to the host receptors also induces capsid rearrangents leading to surface exposure of VP1 N-terminus, specifically its phospholipase A2-like region and nuclear localization signal(s). VP1 N-terminus might serve as a lipolytic enzyme to breach the endosomal membrane during entry into host cell. Intracytoplasmic transport involves microtubules and interaction between capsid proteins and host dynein. Exposure of nuclear localization signal probably allows nuclear import of capsids.
References
Nucleotide sequence and genome organization of human parvovirus B19 isolated from the serum of a child during aplastic crisis.Shade R.O., Blundell M.C., Cotmore S.F., Tattersall P., Astell C.R.J. Virol. 58:921-936(1986) Alpha5beta1 integrin as a cellular coreceptor for human parvovirus B19 requirement of functional activation of beta1 integrin for viral entry.Weigel-Kelley K.A., Yoder M.C., Srivastava A.Blood 102:3927-3933(2003) The globoside receptor triggers structural changes in the B19 virus capsid that facilitate virus internalization.Boensch C., Zuercher C., Lieby P., Kempf C., Ros C.J. Virol. 84:11737-11746(2010) Advances in human B19 erythrovirus biology.Servant-Delmas A., Lefrere J.J., Morinet F., Pillet S.J. Virol. 84:9658-9665(2010)

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
64.8 kDa
UniProt Protein Name
Capsid protein VP1
UniProt Entry Name
CAPSD_PAVHU

Similar Products

Product Notes

The VP2 (Catalog #AAA18557) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 228-781aa; partial. The amino acid sequence is listed below: MTSVNSAEAS TGAGGGGSNS VKSMWSEGAT FSANSVTCTF SRQFLIPYDP EHHYKVFSPA ASSCHNASGK EAKVCTISPI MGYSTPWRYL DFNALNLFFS PLEFQHLIEN YGSIAPDALT VTISEIAVKD VTDKTGGGVQ VTDSTTGRLC MLVDHEYKYP YVLGQGQDTL APELPIWVYF PPQYAYLTVG DVNTQGISGD SKKLASEESA FYVLEHSSFQ LLGTGGTASM SYKFPPVPPE NLEGCSQHFY EMYNPLYGSR LGVPDTLGGD PKFRSLTHED HAIQPQNFMP GPLVNSVSTK EGDSSNTGAG KALTGLSTGT SQNTRISLRP GPVSQPYHHW DTDKYVTGIN AISHGQTTYG NAEDKEYQQG VGRFPNEKEQ LKQLQGLNMH TYFPNKGTQQ YTDQIERPLM VGSVWNRRAL HYESQLWSKI PNLDDSFKTQ FAALGGWGLH QPPPQIFLKI LPQSGPIGGI KSMGITTLVQ YAVGIMTVTM TFKLGPRKAT GRWNPQPGVY PPHAAGHLPY VLYDPTATDA KQHHRHGYEK PEELWTAKSR VHPL . It is sometimes possible for the material contained within the vial of "parvovirus B19 Capsid protein VP1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.