Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Protocadherin gamma-B3 (PCDHGB3) Recombinant Protein | PCDHGB3 recombinant protein

Recombinant Human Protocadherin gamma-B3 (PCDHGB3), partial

Gene Names
PCDHGB3; PCDH-GAMMA-B3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protocadherin gamma-B3 (PCDHGB3); N/A; Recombinant Human Protocadherin gamma-B3 (PCDHGB3), partial; PCDHGB3 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
31-444aa; Partial
Sequence
EPIRYAIPEELDRGSLVGNLAKDLGFGVGDLPTRNLRVIAEKKFFTVSPENGNLLVSDRIDREEICGKKSTCVLEFEMVAEKPLNFFHVTVLIQDINDNPPTFSQNITELEISELALTGATFALESAQDPDVGVNSLQQYYLSPDPHFSLIQKENLDGSRYPELVLKAPLDREEQPHHHLVLTAVDGGEPSRSCTTQIRVIVADANDNPPVFTQDMYRVNVAENLPAGSSVLKVMAIDMDEGINAEIIYAFINIGKEVRQLFKLDSKTGELTTIGELDFEERDSYTIGVEAKDGGHHTAYCKVQIDISDENDNAPEITLASESQHIQEDAELGTAVALIKTHDLDSGFNGEILCQLKGNFPFKIVQDTKNTYRLVTDGALDREQIPEYNVTITATDKGNPPLSSSKTITLHILD
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PCDHGB3 recombinant protein
This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89,342 Da
NCBI Official Full Name
protocadherin gamma-B3 isoform 1
NCBI Official Synonym Full Names
protocadherin gamma subfamily B, 3
NCBI Official Symbol
PCDHGB3
NCBI Official Synonym Symbols
PCDH-GAMMA-B3
NCBI Protein Information
protocadherin gamma-B3
UniProt Protein Name
Protocadherin gamma-B3
UniProt Gene Name
PCDHGB3
UniProt Synonym Gene Names
PCDH-gamma-B3

Similar Products

Product Notes

The PCDHGB3 pcdhgb3 (Catalog #AAA117543) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 31-444aa; Partial. The amino acid sequence is listed below: EPIRYAIPEE LDRGSLVGNL AKDLGFGVGD LPTRNLRVIA EKKFFTVSPE NGNLLVSDRI DREEICGKKS TCVLEFEMVA EKPLNFFHVT VLIQDINDNP PTFSQNITEL EISELALTGA TFALESAQDP DVGVNSLQQY YLSPDPHFSL IQKENLDGSR YPELVLKAPL DREEQPHHHL VLTAVDGGEP SRSCTTQIRV IVADANDNPP VFTQDMYRVN VAENLPAGSS VLKVMAIDMD EGINAEIIYA FINIGKEVRQ LFKLDSKTGE LTTIGELDFE ERDSYTIGVE AKDGGHHTAY CKVQIDISDE NDNAPEITLA SESQHIQEDA ELGTAVALIK THDLDSGFNG EILCQLKGNF PFKIVQDTKN TYRLVTDGAL DREQIPEYNV TITATDKGNP PLSSSKTITL HILD. It is sometimes possible for the material contained within the vial of "Protocadherin gamma-B3 (PCDHGB3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.