Proprotein convertase subtilisin/kexin type 5 Recombinant Protein | Pcsk5 recombinant protein
Recombinant Mouse Proprotein convertase subtilisin/kexin type 5
Gene Names
Pcsk5; PC5; PC6; SPC6; b2b585Clo; b2b1549Clo
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Proprotein convertase subtilisin/kexin type 5; N/A; Recombinant Mouse Proprotein convertase subtilisin/kexin type 5; Proprotein convertase 5; PC5; Proprotein convertase 6; PC6; Subtilisin-like proprotein convertase 6; SPC6; Subtilisin/kexin-like protease PC5; Pcsk5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
117-452aa; Full Length
Sequence
DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAE
Sequence Length
452
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Pcsk5 recombinant protein
Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors.
References
Identification of an isoform with an extremely large Cys-rich region of PC6, a Kex2-like processing endoprotease.Nakagawa T., Murakami K., Nakayama K.FEBS Lett. 327:165-171(1993) Identification and functional expression of a new member of the mammalian Kex2-like processing endoprotease family its striking structural similarity to PACE4.Nakagawa T., Hosaka M., Torii S., Watanabe T., Murakami K., Nakayama K.J. Biochem. 113:132-135(1993) cDNA structure of the mouse and rat subtilisin/kexin-like PC5 a candidate proprotein convertase expressed in endocrine and nonendocrine cells.Lusson J., Vieau D., Hamelin J., Day R., Chretien M., Seidah N.G.Proc. Natl. Acad. Sci. U.S.A. 90:6691-6695(1993) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) The isoforms of proprotein convertase PC5 are sorted to different subcellular compartments.De Bie I., Marcinkiewicz M., Malide D., Lazure C., Nakayama K., Bendayan M., Seidah N.G.J. Cell Biol. 135:1261-1275(1996) SPC4, SPC6, and the novel protease SPC7 are coexpressed with bone morphogenetic proteins at distinct sites during embryogenesis.Constam D.B., Calfon M., Robertson E.J.J. Cell Biol. 134:181-191(1996) Murine subtilisin-like proteinase SPC6 is expressed during embryonic implantation, somitogenesis, and skeletal formation.Rancourt S.L., Rancourt D.E.3.0.CO;2-5>Dev. Genet. 21:75-81(1997)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38.7 kDa
NCBI Official Full Name
proprotein convertase subtilisin/kexin type 5 isoform 1 preproprotein
NCBI Official Synonym Full Names
proprotein convertase subtilisin/kexin type 5
NCBI Official Symbol
Pcsk5
NCBI Official Synonym Symbols
PC5; PC6; SPC6; b2b585Clo; b2b1549Clo
NCBI Protein Information
proprotein convertase subtilisin/kexin type 5
UniProt Protein Name
Proprotein convertase subtilisin/kexin type 5
UniProt Gene Name
Pcsk5
UniProt Synonym Gene Names
PC5; PC6; SPC6
UniProt Entry Name
PCSK5_MOUSE
Similar Products
Product Notes
The Pcsk5 pcsk5 (Catalog #AAA113464) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 117-452aa; Full Length. The amino acid sequence is listed below: DYDLSHAQST YFNDPKWPSM WYMHCSDNTH PCQSDMNIEG AWKRGYTGKN IVVTILDDGI ERTHPDLMQN YDALASCDVN GNDLDPMPRY DASNENKHGT RCAGEVAATA NNSHCTVGIA FNAKIGGVRM LDGDVTDMVE AKSVSYNPQH VHIYSASWGP DDDGKTVDGP APLTRQAFEN GVRMGRRGLG SVFVWASGNG GRSKDHCSCD GYTNSIYTIS ISSTAESGKK PWYLEECSST LATTYSSGES YDKKIITTDL RQRCTDNHTG TSASAPMAAG IIALALEANP FLTWRDVQHV IVRTSRAGHL NANDWKTNAA GFKVSHLYGF GLMDAE. It is sometimes possible for the material contained within the vial of "Proprotein convertase subtilisin/kexin type 5, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
