Peptide deformylase, mitochondrial (PDF) Recombinant Protein | PDF recombinant protein
Recombinant Human Peptide deformylase, mitochondrial (PDF)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peptide deformylase, mitochondrial (PDF); N/A; Recombinant Human Peptide deformylase, mitochondrial (PDF); PDF recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
40-243aa; Full Length of Mature Protein
Sequence
EGPALRRSYWRHLRRLVLGPPEPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PDF recombinant protein
Protein synthesis proceeds after formylation of methionine by methionyl-tRNA formyl transferase (FMT) and transfer of the charged initiator f-met tRNA to the ribosome. In eubacteria and eukaryotic organelles the product of this gene, peptide deformylase (PDF), removes the formyl group from the initiating methionine of nascent peptides. In eubacteria, deformylation of nascent peptides is required for subsequent cleavage of initiating methionines by methionine aminopeptidase. The discovery that a natural inhibitor of PDF, actinonin, acts as an antimicrobial agent in some bacteria has spurred intensive research into the design of bacterial-specific PDF inhibitors. In human cells, only mitochondrial proteins have N-formylation of initiating methionines. Protein inhibitors of PDF or siRNAs of PDF block the growth of cancer cell lines but have no effect on normal cell growth. In humans, PDF function may therefore be restricted to rapidly growing cells.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,013 Da
NCBI Official Full Name
peptide deformylase, mitochondrial
NCBI Official Synonym Full Names
peptide deformylase, mitochondrial
NCBI Official Symbol
PDF
NCBI Protein Information
peptide deformylase, mitochondrial
UniProt Protein Name
Peptide deformylase, mitochondrial
UniProt Gene Name
PDF
UniProt Synonym Gene Names
PDF1A
Similar Products
Product Notes
The PDF pdf (Catalog #AAA117264) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 40-243aa; Full Length of Mature Protein. The amino acid sequence is listed below: EGPALRRSYW RHLRRLVLGP PEPPFSHVCQ VGDPVLRGVA APVERAQLGG PELQRLTQRL VQVMRRRRCV GLSAPQLGVP RQVLALELPE ALCRECPPRQ RALRQMEPFP LRVFVNPSLR VLDSRLVTFP EGCESVAGFL ACVPRFQAVQ ISGLDPNGEQ VVWQASGWAA RIIQHEMDHL QGCLFIDKMD SRTFTNVYWM KVND. It is sometimes possible for the material contained within the vial of "Peptide deformylase, mitochondrial (PDF), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.