SDS-PAGE
Putative L-asparaginase Recombinant Protein | PF0142 recombinant protein
Recombinant Pyrococcus furiosus (strain 43587 / DSM 3638 / JCM 8422 / Vc1) Putative L-asparaginase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative L-asparaginase; N/A; Recombinant Pyrococcus furiosus (strain 43587 / DSM 3638 / JCM 8422 / Vc1) Putative L-asparaginase; L-asparagine amidohydrolase; Cleaved into the following 2 chains: Putative L-asparaginase subunit alpha; Putative L-asparaginase subunit beta; PF0142 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-175aa; Partial
Sequence
MVAIIVHGGAGTIRKEERIPKIIEGVREAVLTGWRELKKGSALDAVEEAVKVLEDNPLFNAGTGSVLTLDGKVEMDAAIMRGKTLDAGAVAGIWGVKNPISVARKVMEKTDHVLLIGEGAVKFARLMGFPEYDPTTEERRKQWEELRKKLLETGEIRHWKKLSELIKEYPEVLRS
Sequence Length
306
Species
Pyrococcus furiosus (strain # 43587 / DSM 3638 / JCM 8422 / Vc1)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for PF0142 recombinant protein
L-asparagine + H2O = L-aspartate + NH3.
References
"Divergence of the hyperthermophilic archaea Pyrococcus furiosus and P. horikoshii inferred from complete genomic sequences." Maeder D.L., Weiss R.B., Dunn D.M., Cherry J.L., Gonzalez J.M., DiRuggiero J., Robb F.T. Genetics 152:1299-1305(1999)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.5 kDa
NCBI Official Full Name
asparaginase
NCBI Official Symbol
PF_RS00725
NCBI Protein Information
asparaginase
UniProt Protein Name
Putative L-asparaginase
UniProt Gene Name
PF0142
UniProt Entry Name
ASGX_PYRFU
Similar Products
Product Notes
The PF0142 pf0142 (Catalog #AAA117144) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-175aa; Partial. The amino acid sequence is listed below: MVAIIVHGGA GTIRKEERIP KIIEGVREAV LTGWRELKKG SALDAVEEAV KVLEDNPLFN AGTGSVLTLD GKVEMDAAIM RGKTLDAGAV AGIWGVKNPI SVARKVMEKT DHVLLIGEGA VKFARLMGFP EYDPTTEERR KQWEELRKKL LETGEIRHWK KLSELIKEYP EVLRS. It is sometimes possible for the material contained within the vial of "Putative L-asparaginase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.