Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283401_AD13.png Application Data (The purity of Mouse CXCL4 is greater than 95% as determined by SEC-HPLC.)

CXCL4/PF-4 Recombinant Protein | CXCL4 recombinant protein

Recombinant Mouse CXCL4/PF-4 Protein

Average rating 0.0
No ratings yet
Purity
PBS
Synonyms
CXCL4/PF-4; N/A; Recombinant Mouse CXCL4/PF-4 Protein; Pf4, Cxcl4, Scyb4, Platelet factor 4, PF-4, C-X-C motif chemokine 4; CXCL4 recombinant protein
Ordering
Host
HEK293 cells
Purity/Purification
PBS
Form/Format
Lyophilized from 0.22 um filtered solution in PBS (pH7.4). Normally 8% trehalose is added as protectant before lyophilization.
Sequence
VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
Species
Mouse
Tag
C-hFc
Endotoxin
<0.01 EU/ug
Bio-Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CCL5 at 5ug/mL (100 uL/well) can bind Mouse CXCL4 with a linear range of 10-252.6ng/mL.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(The purity of Mouse CXCL4 is greater than 95% as determined by SEC-HPLC.)

product-image-AAA283401_AD13.png Application Data (The purity of Mouse CXCL4 is greater than 95% as determined by SEC-HPLC.)

SDS-PAGE

(Recombinant Mouse CXCL4/PF-4 Protein 1/FSTL1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 40-45kDa.)

product-image-AAA283401_SDS_PAGE15.jpg SDS-PAGE (Recombinant Mouse CXCL4/PF-4 Protein 1/FSTL1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 40-45kDa.)
Related Product Information for CXCL4 recombinant protein
Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. As a strong chemoattractant for neutrophils and fibroblasts, PF4 probably has a role in inflammation and wound repair.
Product Categories/Family for CXCL4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
Platelet factor 4
UniProt Gene Name
Pf4
UniProt Synonym Gene Names
Cxcl4; Scyb4; PF-4
UniProt Entry Name
PLF4_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CXCL4 pf4 (Catalog #AAA283401) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: VTSAGPEESD GDLSCVCVKT ISSGIHLKHI TSLEVIKAGR HCAVPQLIAT LKNGRKICLD RQAPLYKKVI KKILES. It is sometimes possible for the material contained within the vial of "CXCL4/PF-4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.