Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA116159_SDS_PAGE15.png SDS-PAGE

Progesterone receptor Recombinant Protein | PGR recombinant protein

Recombinant Human Progesterone receptor(PGR)

Average rating 0.0
No ratings yet
Gene Names
PGR; PR; NR3C3
Applications
Calibrator
Purity
85% ± 5% by SDS-PAGE
Synonyms
Progesterone receptor; N/A; Recombinant Human Progesterone receptor(PGR); Nuclear receptor subfamily 3 group C member 3; PGR recombinant protein
Ordering
Host
E Coli
Purity/Purification
85% ± 5% by SDS-PAGE
Form/Format
Liquid, dissolved in 20mM Tris-HCl, 500mM NaCl, pH 8.0, 50% glycerol
Sequence Positions
4-232
Sequence
LKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEES
Sequence Length
933
Applicable Applications for PGR recombinant protein
Calibrator
Tag
GST-tag
Product Note
Applications are user defined. Product is developed and quality control tested in house, data or additional information may be provided upon request. The researcher needs to establish and confirm the suitability of the product for their application.
Preparation and Storage
Aliquot and store at < =-20 degree C. Avoid repeated freeze / thaw cycles. -20 degree C for one year.

SDS-PAGE

product-image-AAA116159_SDS_PAGE15.png SDS-PAGE
Related Product Information for PGR recombinant protein
The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Progesterone receptor isoform B (PRB) is involved activation of c-SRC/MAPK signaling on hormone stimulation. Isoform A: inactive in stimulating c-Src/MAPK signaling on hormone stimulation. Isoform 4: Increases mitochondrial membrane potential and cellular respiration upon stimulation by progesterone.
Product Categories/Family for PGR recombinant protein
References
Two distinct estrogen-regulated promoters generate transcripts encoding the two functionally different human progesterone receptor forms A and B.Kastner P., Krust A., Turcotte B., Stropp U., Tora L., Gronemeyer H., Chambon P.EMBO J. 9:1603-1614(1990) Complete amino acid sequence of the human progesterone receptor deduced from cloned cDNA.Misrahi M., Atger M., D'Auriol L., Loosfelt H., Meriel C., Fridlansky F., Guiochon-Mantel A., Galibert F., Milgrom E.Biochem. Biophys. Res. Commun. 143:740-748(1987) Kieback D.G., Agoulnik I.U., Tong X.-W.Progesterone Receptor, alternative splicing variant, mRNA.Hisatomi H., Wakita K., Kohno N., Nagao K., Hirata H., Hikiji K. The human progesterone receptor shows evidence of adaptive evolution associated with its ability to act as a transcription factor.Chen C., Opazo J.C., Erez O., Uddin M., Santolaya-Forgas J., Goodman M., Grossman L.I., Romero R., Wildman D.E.Mol. Phylogenet. Evol. 47:637-649(2008) Cloning and expression of a novel, truncated, progesterone receptor.Saner K.J., Welter B.H., Zhang F., Hansen E., Dupont B., Wei Y., Price T.M.Mol. Cell. Endocrinol. 200:155-163(2003) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) NIEHS SNPs programHuman chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
progesterone receptor isoform B
NCBI Official Synonym Full Names
progesterone receptor
NCBI Official Symbol
PGR
NCBI Official Synonym Symbols
PR; NR3C3
NCBI Protein Information
progesterone receptor
UniProt Protein Name
Progesterone receptor
UniProt Gene Name
PGR
UniProt Synonym Gene Names
NR3C3; PR
UniProt Entry Name
PRGR_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PGR pgr (Catalog #AAA116159) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 4-232. AAA Biotech's Progesterone receptor can be used in a range of immunoassay formats including, but not limited to, Calibrator. Researchers should empirically determine the suitability of the PGR pgr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LKAKGPRAPH VAGGPPSPEV GSPLLCRPAA GPFPGSQTSD TLPEVSAIPI SLDGLLFPRP CQGQDPSDEK TQDQQSLSDV EGAYSRAEAT RGAGGSSSSP PEKDSGLLDS VLDTLLAPSG PGQSQPSPPA CEVTSSWCLF GPELPEDPPA APATQRVLSP LMSRSGCKVG DSSGTAAAHK VLPRGLSPAR QLLLPASESP HWSGAPVKPS PQAAAVEVEE EDGSESEES. It is sometimes possible for the material contained within the vial of "Progesterone receptor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.