Secreted Phospholipase A2-X Recombinant Protein | PLA2G10 recombinant protein
Recombinant Human Secreted Phospholipase A2-X
Gene Names
PLA2G10; SPLA2; GXPLA2; GXSPLA2
Purity
Greater than 95% as determined by SDS PAGE.
Synonyms
Secreted Phospholipase A2-X; N/A; Recombinant Human Secreted Phospholipase A2-X; PLA2G10 Human; Secreted Phospholipase A2-X Human Recombinant; Group 10 secretory phospholipase A2; EC 3.1.1.4; Group X secretory phospholipase A2; Phosphatidylcholine 2-acylhydrolase GX; GX sPLA2; sPLA2-X; SPLA2; GXPLA2; MGC119918; MGC119919; MGC133367; PLA2G10; PLA2G10 recombinant protein
Host
E Coli
Purity/Purification
Greater than 95% as determined by SDS PAGE.
Form/Format
Sterile Filtered lyophilized (freeze-dried) powder.
PLA2G10 filtered (0.4 µm) and lyophilized from 0.5mg/ml solution in 20mM Tris and 50mM NaCl, pH 7.5.
PLA2G10 filtered (0.4 µm) and lyophilized from 0.5mg/ml solution in 20mM Tris and 50mM NaCl, pH 7.5.
Sequence
MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
Sequence Length
165
Solubility
Add 0.2 ml of distilled water and let the lyophilized pellet dissolve completely.
Preparation and Storage
Store lyophilized protein at -20 degree C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 degree C for a limited period of time; it does not show any change after two weeks at 4°C.
Related Product Information for PLA2G10 recombinant protein
Description: Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag.
Product Categories/Family for PLA2G10 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
group 10 secretory phospholipase A2
NCBI Official Synonym Full Names
phospholipase A2, group X
NCBI Official Symbol
PLA2G10
NCBI Official Synonym Symbols
SPLA2; GXPLA2; GXSPLA2
NCBI Protein Information
group 10 secretory phospholipase A2; GX sPLA2; group X secretory phospholipase A2; phosphatidylcholine 2-acylhydrolase 10; sPLA2-X
UniProt Protein Name
Group 10 secretory phospholipase A2
UniProt Gene Name
PLA2G10
UniProt Synonym Gene Names
GX sPLA2; sPLA2-X
UniProt Entry Name
PA2GX_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The PLA2G10 pla2g10 (Catalog #AAA38281) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MRGSHHHHHH GMASHMGILE LAGTVGCVGP RTPIAYMKYG CFCGLGGHGQ PRDAIDWCCH GHDCCYTRAE EAGCSPKTER YSWQCVNQSV LCGPAENKCQ ELLCKCDQEI ANCLAQTEYN LKYLFYPQFL CEPDSPKCD. It is sometimes possible for the material contained within the vial of "Secreted Phospholipase A2-X, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.