Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

Group XV phospholipase A2 (Pla2g15) Recombinant Protein | Pla2g15 recombinant protein

Recombinant Mouse Group XV phospholipase A2 (Pla2g15)

Gene Names
Pla2g15; ACS; LLPL; Lpla2; C87498; Lypla3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Group XV phospholipase A2 (Pla2g15); Recombinant Mouse Group XV phospholipase A2 (Pla2g15); Pla2g15 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
34-412aa; Full Length of Mature Protein
Sequence
AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Pla2g15 recombinant protein
Has transacylase and calcium-independent phospholipase A2 activity. Catalyzes the formation of 1-O-acyl-N-acetylsphingosine and the concomitant release of a lyso-phospholipid. Has high activity with 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC) and 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), catalyzing the transfer of oleic acid to N-acetyl-sphingosine. Required for normal phospholipid degradation in alveolar and peritoneal macrophages and in spleen
Product Categories/Family for Pla2g15 recombinant protein
References
"The measurement of lysosomal phospholipase A2 activity in plasma." Abe A., Kelly R., Shayman J.A. J. Lipid Res. 51:2464-2470(2010)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50.5 kDa
NCBI Official Full Name
group XV phospholipase A2 isoform 1
NCBI Official Synonym Full Names
phospholipase A2, group XV
NCBI Official Symbol
Pla2g15
NCBI Official Synonym Symbols
ACS; LLPL; Lpla2; C87498; Lypla3
NCBI Protein Information
group XV phospholipase A2
UniProt Protein Name
Group XV phospholipase A2
UniProt Gene Name
Pla2g15
UniProt Synonym Gene Names
Lypla3; LPLA2

Similar Products

Product Notes

The Pla2g15 pla2g15 (Catalog #AAA18772) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 34-412aa; Full Length of Mature Protein. The amino acid sequence is listed below: AQRHPPVVLV PGDLGNQLEA KLDKPKVVHY LCSKKTDSYF TLWLNLELLL PVIIDCWIDN IRLVYNRTSR ATQFPDGVDV RVPGFGETFS MEFLDPSKRN VGSYFYTMVE SLVGWGYTRG EDVRGAPYDW RRAPNENGPY FLALREMIEE MYQMYGGPVV LVAHSMGNVY MLYFLQRQPQ VWKDKYIHAF VSLGAPWGGV AKTLRVLASG DNNRIPVIGP LKIREQQRSA VSTSWLLPYN HTWSHEKVFV YTPTTNYTLR DYHRFFRDIG FEDGWFMRQD TEGLVEAMTP PGVELHCLYG TGVPTPNSFY YESFPDRDPK ICFGDGDGTV NLESVLQCQA WQSRQEHRVS LQELPGSEHI EMLANATTLA YLKRVLLEP . It is sometimes possible for the material contained within the vial of "Group XV phospholipase A2 (Pla2g15), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.