Phospholipase A2, membrane associated Recombinant Protein | Pla2g2a recombinant protein
Recombinant Rat Phospholipase A2, membrane associated
Gene Names
Pla2g2a; sPLA2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phospholipase A2, membrane associated; N/A; Recombinant Rat Phospholipase A2, membrane associated; GIIC sPLA2; Group IIA phospholipase A2; Phosphatidylcholine 2-acylhydrolase 2A; Pla2g2a recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-146aa; Full Length
Sequence
SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC
Sequence Length
146
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Pla2g2a recombinant protein
Thought to participate in the regulation of the phospholipid metabolism in biomembranes including eicosanoid biosynthesis. Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.
References
Structure of cDNA coding for rat platelet phospholipase A2.Komada M., Kudo I., Mizushima H., Kitamura N., Inoue K.J. Biochem. 106:545-547(1989) Structure of gene coding for rat group II phospholipase A2.Komada M., Kudo I., Inoue K.Biochem. Biophys. Res. Commun. 168:1059-1065(1990) cDNA cloning and sequence determination of rat membrane-associated phospholipase A2.Ishizaki J., Ohara O., Nakamura E., Tamaki M., Ono T., Kanda A., Yoshida N., Teraoka H., Tojo H., Okamoto M.Biochem. Biophys. Res. Commun. 162:1030-1036(1989) Structure of genomic DNA for rat platelet phospholipase A2.Kusunoki C., Satoh S., Kobayashi M., Niwa M.Biochim. Biophys. Acta 1087:95-97(1990) The primary structure of rat platelet phospholipase A2.Hayakawa M., Kudo I., Tomita M., Nojima S., Inoue K.J. Biochem. 104:767-772(1988) Purification and characterization of a membrane-associated phospholipase A2 from rat spleen. Its comparison with a cytosolic phospholipase A2 S-1.Ono T., Tojo H., Kuramitsu S., Kagamiyama H., Okamoto M.J. Biol. Chem. 263:5732-5738(1988) Amino acid composition and NH2-terminal amino acid sequence of rat platelet secretory phospholipase A2.Hayakawa M., Horigome K., Kudo I., Tomita M., Nojima S., Inoue K.J. Biochem. 101:1311-1314(1987) Immunoaffinity purification, partial sequence, and subcellular localization of rat liver phospholipase A2.Aarsman A.J., de Jong J.G.N., Arnoldussen E., Neys F.W., van Wassenaar P.D., van den Bosch H.J. Biol. Chem. 264:10008-10014(1989)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16.1 kDa
NCBI Official Full Name
phospholipase A2, membrane associated
NCBI Official Synonym Full Names
phospholipase A2 group IIA
NCBI Official Symbol
Pla2g2a
NCBI Official Synonym Symbols
sPLA2
NCBI Protein Information
phospholipase A2, membrane associated
UniProt Protein Name
Phospholipase A2, membrane associated
UniProt Gene Name
Pla2g2a
UniProt Entry Name
PA2GA_RAT
Similar Products
Product Notes
The Pla2g2a pla2g2a (Catalog #AAA115403) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-146aa; Full Length. The amino acid sequence is listed below: SLLEFGQMIL FKTGKRADVS YGFYGCHCGV GGRGSPKDAT DWCCVTHDCC YNRLEKRGCG TKFLTYKFSY RGGQISCSTN QDSCRKQLCQ CDKAAAECFA RNKKSYSLKY QFYPNKFCKG KTPSC. It is sometimes possible for the material contained within the vial of "Phospholipase A2, membrane associated, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
