Platelet-activating factor acetylhydrolase (Pla2g7) Recombinant Protein | Pla2g7 recombinant protein
Recombinant Mouse Platelet-activating factor acetylhydrolase (Pla2g7)
Gene Names
Pla2g7; PAF-AH; R75400
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Platelet-activating factor acetylhydrolase (Pla2g7); N/A; Recombinant Mouse Platelet-activating factor acetylhydrolase (Pla2g7); Pla2g7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-440, full length protein
Sequence
FHWQDTSSFDFRPSVMFHKLQSVMSAAGSGHSKIPKGNGSYPVGCTDLMFGYGNESVFVRLYYPAQDQGRLDTVWIPNKEYFLGLSIFLGTPSIVGNILHLLYGSLTTPASWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRDRSASATYFFEDQVAAKVENRSWLYLRKVKQEESESVRKEQVQQRAIECSRALSAILDIEHGDPKENVLGSAFDMKQLKDAIDETKIALMGHSFGGATVLQALSEDQRFRCGVALDPWMYPVNEELYSRTLQPLLFINSAKFQTPKDIAKMKKFYQPDKERKMITIKGSVHQNFDDFTFVTGKIIGNKLTLKGEIDSRVAIDLTNKASMAFLQKHLGLQKDFDQWDPLVEGDDENLIPGSPFDAVTQVPAQQHSPGSQTQN
Sequence Length
419
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49,258 Da
NCBI Official Full Name
platelet-activating factor acetylhydrolase
NCBI Official Synonym Full Names
phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma)
NCBI Official Symbol
Pla2g7
NCBI Official Synonym Symbols
PAF-AH; R75400
NCBI Protein Information
platelet-activating factor acetylhydrolase
UniProt Protein Name
Platelet-activating factor acetylhydrolase
UniProt Gene Name
Pla2g7
UniProt Synonym Gene Names
Pafah; PAF acetylhydrolase; LDL-PLA(2)
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Pla2g7 pla2g7 (Catalog #AAA116598) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-440, full length protein. The amino acid sequence is listed below: FHWQDTSSFD FRPSVMFHKL QSVMSAAGSG HSKIPKGNGS YPVGCTDLMF GYGNESVFVR LYYPAQDQGR LDTVWIPNKE YFLGLSIFLG TPSIVGNILH LLYGSLTTPA SWNSPLRTGE KYPLIVFSHG LGAFRTIYSA IGIGLASNGF IVATVEHRDR SASATYFFED QVAAKVENRS WLYLRKVKQE ESESVRKEQV QQRAIECSRA LSAILDIEHG DPKENVLGSA FDMKQLKDAI DETKIALMGH SFGGATVLQA LSEDQRFRCG VALDPWMYPV NEELYSRTLQ PLLFINSAKF QTPKDIAKMK KFYQPDKERK MITIKGSVHQ NFDDFTFVTG KIIGNKLTLK GEIDSRVAID LTNKASMAFL QKHLGLQKDF DQWDPLVEGD DENLIPGSPF DAVTQVPAQQ HSPGSQTQN. It is sometimes possible for the material contained within the vial of "Platelet-activating factor acetylhydrolase (Pla2g7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.