Secretory Phospholipase A2 Receptor 1 Recombinant Protein | PLA2R1 recombinant protein

Recombinant Human Secretory Phospholipase A2 Receptor 1, PLA2R1

Cat. Num. AAA47142

• Gene Names: PLA2R1; PLA2R; PLA2-R; PLA2IR; CLEC13C; PLA2G1R
• Applications: Functional Assay, Western Blot
• Purity: Affinity chromatography. >95% as estimated by SDS-PAGE stained with Instant Blue Stain (Expedeon).
• Synonyms: Secretory Phospholipase A2 Receptor 1; N/A; Recombinant Human Secretory Phospholipase A2 Receptor 1, PLA2R1; 180 kDa secretory phospholipase A2 receptor; C-type lectin domain family 13 member C; M-type receptor; PLA2R1 recombinant protein

• Host: HEK293 Cells
• Purity/Purification: Affinity chromatography. >95% as estimated by SDS-PAGE stained with Instant Blue Stain (Expedeon).
• Form/Format: PBS 10% Glycerol
• Concentration: Amounts and concentration: 80ul of 1.74mg/mL by A280 absorbance = 139ug total protein (varies by lot)
• Sequence Positions: 21-173aa
• Sequence: EGVAAALTPERLLEWQDKGIFVIQSESLKKCIQAGKSVLTLENCKQANKHMLWKWVSNHGLFNIGGSGCLGLNFSAPEQPLSLYECDSTLVSLRWRCNRKMITGPLQYSVQVAHDNTVVASRKYIHKWISYGSGGGDICEYLHKDLHTIKGNTGSGHHHHHHHHHHRRKR

• Applicable Applications for PLA2R1 recombinant protein: FA (Functional Assay), IA (Immunoassay), WB (Western Blot)
• Species: Human
• Tag: 10xHis at the C-terminus
• Endotoxin: Less than 0.1ng/ug (1 IEU/ug), as measured by LAL method.
• Dry Ice Shipment: Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
• Preparation and Storage: Store at -20 degree or -70 degree C for at least 12 months preferably in small aliquots to avoid repeated freeze-thaw cycles.; Ships on Dry ice

SDS-PAGE

Related Product Information for PLA2R1 recombinant protein

PLA2R is a type I transmembrane glycoprotein of 180-200 kDa and is present in a widevariety of cells and tissues (1). Receptor for secretory phospholipase A2 (sPLA2) belongingto the mannose receptor family (2). It is composed of a large extracellular N-terminalportion, consisting of a N-terminal cystein-rich region, a fibronectin-like type II domain, atandem repeat of eight carbohydrate-recognition domains essential for ligand binding, and short intracellular C-terminal region. Acts as a receptor for phosholipase sPLA2-IB/PLA2G1B. Also able to bind to snake PA2-like toxins. Binding of sPLA2-IB/PLA2G1B induces various effects depending on the cell type, such as activation of the mitogenactivated protein kinase (MAPK) cascade to induce cell proliferation, the production of lipidmediators, selective release of arachidonic acid in bone marrow-derived mast cells. Inneutrophils, binding of sPLA2-IB/PLA2G1B can activate p38 MAPK to stimulate elastaserelease and cell adhesion. May be involved in responses in proinflammatory cytokine productions during endotoxic shock (3). The soluble secretory phospholipase A2 receptorform is circulating and acts as a negative regulator of sPLA2 functions by blocking thebiological functions of sPLA2-IB/PLA2G1B.
PLA2R is expressed on the surface of podocytes and represents a target auto antigen in 70%of patients with idiopathic membranous nephropathy (4). It has a test value indetecting and quantifying anti-PLA2R autoimmunity.

References

Fresquet M., Jowitt TA., Gummadova J., Collins R., O'Cualain R., McKenzie EA., Lennon R. and PE. Brenchley. Identification of a Major Epitope Recognised by PLA2R Autoantibodies in Primary Membranous Nephropathy. Journal of American Society of Nephrology. Vol. 26, No 2, pp 302-313. 2015.

NCBI and Uniprot Product Information

• NCBI GI #: 119631798
• NCBI GeneID: 22925
• UniProt Accession #: Q13018; Q13019; Q15095; Q53R45; Q53RR7; B2RTU9; D3DPB1
• Molecular Weight: Predicted MW: 19.3 kDa; Estimated MW SDS-PAGE: ~24 kDa
• NCBI Official Full Name: phospholipase A2 receptor 1, 180kDa, isoform CRA_b
• NCBI Official Synonym Full Names: phospholipase A2 receptor 1, 180kDa
• NCBI Official Symbol: PLA2R1
• NCBI Official Synonym Symbols: PLA2R; PLA2-R; PLA2IR; CLEC13C; PLA2G1R
• NCBI Protein Information: secretory phospholipase A2 receptor; M-type receptor; phospholipase A2 receptor 1, 180kD; C-type lectin domain family 13 member C; 180 kDa secretory phospholipase A2 receptor
• UniProt Protein Name: Secretory phospholipase A2 receptor
• UniProt Gene Name: PLA2R1
• UniProt Synonym Gene Names: CLEC13C; PLA2-R; PLA2R; Soluble PLA2-R
• UniProt Entry Name: PLA2R_HUMAN