Secretory Phospholipase A2 Receptor 1 Recombinant Protein | PLA2R1 recombinant protein
Recombinant Human Secretory Phospholipase A2 Receptor 1, PLA2R1
Gene Names
PLA2R1; PLA2R; PLA2-R; PLA2IR; CLEC13C; PLA2G1R
Purity
Grade & Purity: >95% as estimated by SDS-PAGE stained with Instant Blue Stain (Expedeon)
Synonyms
Secretory Phospholipase A2 Receptor 1; N/A; Recombinant Human Secretory Phospholipase A2 Receptor 1, PLA2R1; 180 kDa secretory phospholipase A2 receptor; C-type lectin domain family 13 member C; M-type receptor; PLA2R1 recombinant protein
Host
HEK293
Purity/Purification
Grade & Purity: >95% as estimated by SDS-PAGE stained with Instant Blue Stain (Expedeon)
Form/Format
PBS 20% Glycerol
Sequence Positions
21-663aa
Sequence
EGVAAALTPERLLEWQDKGIFVIQSESLKKCIQAGKSVLTLENCKQANKHMLWKWVSNHGLFNIGGSGCLGLNFSAPEQ
PLSLYECDSTLVSLRWRCNRKMITGPLQYSVQVAHDNTVVASRKYIHKWISYGSGGGDICEYLHKDLHTIKGNTHGMPCM
FPFQYNHQWHHECTREGREDDLLWCATTSRYERDEKWGFCPDPTSAEVGCDTIWEKDLNSHICYQFNLLSSLSWSEAHS
SCQMQGGTLLSITDETEENFIREHMSSKTVEVWMGLNQLDEHAGWQWSDGTPLNYLNWSPEVNFEPFVEDHCGTFSSF
MPSAWRSRDCESTLPYICKKYLNHIDHEIVEKDAWKYYATHCEPGWNPYNRNCYKLQKEEKTWHEALRSCQADNSALID
ITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERL
FYICKKAGHVLSDAESGCQEGWERHGGFCYKIDTVLRSFDQASSGYYCPPALVTITNRFEQAFITSLISSVVKMKDSYFWIA
LQDQNDTGEYTWKPVGQKPEPVQYTHWNTHQPRYSGGCVAMRGRHPLGRWEVKHCRHFKAMSLCKQPVENQEKAEY
EERWPFHPGSGHHHHHHHHHH
Source
Human
Tag
10xHis at the C-terminus
Endotoxin
Less than 0.1ng/ug (1 IEU/ug), as measured by LAL method.
Dry Ice Note
The product may be shipped with dry ice, and an additional fee may be added to your shipping cost.
Preparation and Storage
The protein should be stored at -20°C to -70°C preferably in small aliquots to avoid repeated freeze-thaw cycles. It can be stored at 2°C to 8°C for 1 Month.
Related Product Information for PLA2R1 recombinant protein
PLA2R is a type I transmembrane glycoprotein of 180-200 kDa and is present in a widevariety of cells and tissues (1). Receptor for secretory phospholipase A2 (sPLA2) belongingto the mannose receptor family (2). It is composed of a large extracellular N-terminalportion, consisting of a N-terminal cystein-rich region, a fibronectin-like type II domain, atandem repeat of eight carbohydrate-recognition domains essential for ligand binding, and short intracellular C-terminal region. Acts as a receptor for phosholipase sPLA2-IB/PLA2G1B. Also able to bind to snake PA2-like toxins. Binding of sPLA2-IB/PLA2G1B induces various effects depending on the cell type, such as activation of the mitogenactivated protein kinase (MAPK) cascade to induce cell proliferation, the production of lipidmediators, selective release of arachidonic acid in bone marrow-derived mast cells. Inneutrophils, binding of sPLA2-IB/PLA2G1B can activate p38 MAPK to stimulate elastase release and cell adhesion. May be involved in responses in proinflammatory cytokine productions during endotoxic shock (3). The soluble secretory phospholipase A2 receptorform is circulating and acts as a negative regulator of sPLA2 functions by blocking thebiological functions of sPLA2-IB/PLA2G1B.
PLA2R is expressed on the surface of podocytes and represents a target autoantigen in 70% of patients with idiopathic membranous nephropathy (4). It has a test value indetecting and quantifying anti-PLA2R auto immunity.
PLA2R is expressed on the surface of podocytes and represents a target autoantigen in 70% of patients with idiopathic membranous nephropathy (4). It has a test value indetecting and quantifying anti-PLA2R auto immunity.
References
Fresquet M., Jowitt TA., Gummadova J., Collins R., O'Cualain R., McKenzie EA., Lennon R. and PE. Brenchley. Identification of a Major Epitope Recognised by PLA2R Autoantibodies in Primary Membranous Nephropathy. Journal of American Society of Nephrology. Vol. 26, No 2, pp 302-313. 2015.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
Predicted Molecular Weight: 75.8 kDa
Estimated Molecular Weight, SDS-PAGE: ~85 kDa
Estimated Molecular Weight, SDS-PAGE: ~85 kDa
NCBI Official Full Name
phospholipase A2 receptor 1, 180kDa, isoform CRA_b
NCBI Official Synonym Full Names
phospholipase A2 receptor 1, 180kDa
NCBI Official Symbol
PLA2R1
NCBI Official Synonym Symbols
PLA2R; PLA2-R; PLA2IR; CLEC13C; PLA2G1R
NCBI Protein Information
secretory phospholipase A2 receptor; M-type receptor; phospholipase A2 receptor 1, 180kD; C-type lectin domain family 13 member C; 180 kDa secretory phospholipase A2 receptor
UniProt Protein Name
Secretory phospholipase A2 receptor
UniProt Gene Name
PLA2R1
UniProt Synonym Gene Names
CLEC13C; PLA2-R; PLA2R; Soluble PLA2-R
UniProt Entry Name
PLA2R_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The PLA2R1 pla2r1 (Catalog #AAA47141) is a Recombinant Protein produced from HEK293 and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-663aa. The amino acid sequence is listed below: EGVAAALTPE RLLEWQDKGI FVIQSESLKK CIQAGKSVLT LENCKQANKH MLWKWVSNHG LFNIGGSGCL GLNFSAPEQ PLSLYECDST LVSLRWRCNR KMITGPLQYS VQVAHDNTVV ASRKYIHKWI SYGSGGGDIC EYLHKDLHTI KGNTHGMPCM FPFQYNHQW HHECTREGRE DDLLWCATTS RYERDEKWGF CPDPTSAEVG CDTIWEKDLN SHICYQFNLL SSLSWSEAHS SCQMQGGTL LSITDETEEN FIREHMSSKT VEVWMGLNQL DEHAGWQWSD GTPLNYLNWS PEVNFEPFVE DHCGTFSSF MPSAWRSRDC ESTLPYICKK YLNHIDHEIV EKDAWKYYAT HCEPGWNPYN RNCYKLQKEE KTWHEALRSC QADNSALID ITSLAEVEFL VTLLGDENAS ETWIGLSSNK IPVSFEWSND SSVIFTNWHT LEPHIFPNRS QLCVSAEQSE GHWKVKNCEE RL FYICKKA GHVLSDAESG CQEGWERHGG FCYKIDTVLR SFDQASSGYY CPPALVTITN RFEQAFITSL ISSVVKMKDS YFWIA LQDQ NDTGEYTWKP VGQKPEPVQY THWNTHQPRY SGGCVAMRGR HPLGRWEVKH CRHFKAMSLC KQPVENQEKA EY EERWPFH PGSGHHHHHH HHHH. It is sometimes possible for the material contained within the vial of "Secretory Phospholipase A2 Receptor 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
