Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA23428_WB6.jpg WB (Western Blot) (WB Suggested Anti-A1BG AntibodyTitration: 1.25 ug/mlPositive Control: HepG2 Whole CellA1BG is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit anti-Human A1BG Polyclonal Antibody | anti-A1BG antibody

A1BG antibody - N-terminal region

Gene Names
A1BG; A1B; ABG; GAB; HYST2477
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
A1BG, Antibody; A1BG antibody - N-terminal region; anti-A1BG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF
Sequence Length
495
Applicable Applications for anti-A1BG antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human A1BG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-A1BG AntibodyTitration: 1.25 ug/mlPositive Control: HepG2 Whole CellA1BG is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA23428_WB6.jpg WB (Western Blot) (WB Suggested Anti-A1BG AntibodyTitration: 1.25 ug/mlPositive Control: HepG2 Whole CellA1BG is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(WB Suggested Anti-A1BG AntibodyTitration: 5 ug/mlPositive Control: human liver, human serum, human plasma)

product-image-AAA23428_WB5.jpg WB (Western Blot) (WB Suggested Anti-A1BG AntibodyTitration: 5 ug/mlPositive Control: human liver, human serum, human plasma)

WB (Western Blot)

(WB Suggested Anti-A1BG AntibodyTitration: 0.1ug/mlPositive Control: Fetal Liver)

product-image-AAA23428_WB4.jpg WB (Western Blot) (WB Suggested Anti-A1BG AntibodyTitration: 0.1ug/mlPositive Control: Fetal Liver)

WB (Western Blot)

(Host: RabbitTarget Name: EGFL8Sample Type: HepG2Antibody Dilution: 1.0ug/mlA1BG is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA23428_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: EGFL8Sample Type: HepG2Antibody Dilution: 1.0ug/mlA1BG is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: A1BGSample Type: JurkatAntibody Dilution: 1.0ug/mlA1BG is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA23428_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: A1BGSample Type: JurkatAntibody Dilution: 1.0ug/mlA1BG is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: A1BGSample Type: 721_BAntibody Dilution: 1.0ug/mlA1BG s supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA23428_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: A1BGSample Type: 721_BAntibody Dilution: 1.0ug/mlA1BG s supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-A1BG antibody
This is a rabbit polyclonal antibody against A1BG. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
Product Categories/Family for anti-A1BG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
1
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
alpha-1B-glycoprotein
NCBI Official Synonym Full Names
alpha-1-B glycoprotein
NCBI Official Symbol
A1BG
NCBI Official Synonym Symbols
A1B; ABG; GAB; HYST2477
NCBI Protein Information
alpha-1B-glycoprotein
UniProt Protein Name
Alpha-1B-glycoprotein
UniProt Gene Name
A1BG
UniProt Entry Name
A1BG_HUMAN

Similar Products

Product Notes

The A1BG a1bg (Catalog #AAA23428) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The A1BG antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's A1BG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the A1BG a1bg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAPVSWITPG LKTTAVCRGV LRGVTFLLRR EGDHEFLEVP EAQEDVEATF. It is sometimes possible for the material contained within the vial of "A1BG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.