Rabbit A2BP1 Polyclonal Antibody | anti-RBFOX1 antibody
A2BP1 Antibody - N-terminal region
Gene Names
RBFOX1; 2BP1; FOX1; A2BP1; FOX-1; HRNBP1
Reactivity
Cow, Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
A2BP1, Antibody; A2BP1 Antibody - N-terminal region; anti-RBFOX1 antibody
Host
Rabbit
Reactivity
Cow, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPE
Sequence Length
370
Applicable Applications for anti-RBFOX1 antibody
WB (Western Blot)
Homology
Cow: 100%; Human: 100%; Mouse: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human A2BP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-RBFOX1 antibody
This is a rabbit polyclonal antibody against A2BP1. It was validated on Western Blot
Target Description: Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the gene product of the SCA2 gene which causes familial neurodegenerative diseases. Ataxin-2 binding protein 1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been found but their full length nature has not been determined.
Target Description: Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the gene product of the SCA2 gene which causes familial neurodegenerative diseases. Ataxin-2 binding protein 1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been found but their full length nature has not been determined.
Product Categories/Family for anti-RBFOX1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
RNA binding protein fox-1 homolog 1 isoform 5
NCBI Official Synonym Full Names
RNA binding fox-1 homolog 1
NCBI Official Symbol
RBFOX1
NCBI Official Synonym Symbols
2BP1; FOX1; A2BP1; FOX-1; HRNBP1
NCBI Protein Information
RNA binding protein fox-1 homolog 1
UniProt Protein Name
RNA binding protein fox-1 homolog 1
UniProt Gene Name
RBFOX1
UniProt Synonym Gene Names
A2BP; A2BP1; FOX1; HRNBP1
UniProt Entry Name
RFOX1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The RBFOX1 rbfox1 (Catalog #AAA200789) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The A2BP1 Antibody - N-terminal region reacts with Cow, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's A2BP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RBFOX1 rbfox1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NCEREQLRGN QEAAAAPDTM AQPYASAQFA PPQNGIPAEY TAPHPHPAPE. It is sometimes possible for the material contained within the vial of "A2BP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
