WB (Western Blot)
(Host: RabbitTarget Name: A2MAntibody Dilution: 1.0ug/mlSample Type: Human skin)
Rabbit anti-Human A2M Polyclonal Antibody | anti-A2M antibody
A2M antibody - N-terminal region
Gene Names
A2M; A2MD; CPAMD5; FWP007; S863-7
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
A2M, Antibody; A2M antibody - N-terminal region; anti-A2M antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PVPGHVTVSICRKYSDASDCHGEDSQAFCEKFSGQLNSHGCFYQQVKTKV
Sequence Length
1474
Applicable Applications for anti-A2M antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RabbitTarget Name: A2MAntibody Dilution: 1.0ug/mlSample Type: Human skin)
WB (Western Blot)
(Host: RabbitTarget Name: A2MAntibody Dilution: 1.0ug/mlSample Type: Human skin)
IHC (Immunohistochemistry)
(Rabbit Anti-A2M AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-A2M AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-A2M antibody
This is a rabbit polyclonal antibody against A2M. It was validated on Western Blot
Target Description: Alpha-2-macroglobulin is a protease inhibitor and cytokine transporter. It inhibits many proteases, including trypsin, thrombin and collagenase. A2M is implicated in Alzheimer disease (AD) due to its ability to mediate the clearance and degradation of A-beta, the major component of beta-amyloid deposits.
Target Description: Alpha-2-macroglobulin is a protease inhibitor and cytokine transporter. It inhibits many proteases, including trypsin, thrombin and collagenase. A2M is implicated in Alzheimer disease (AD) due to its ability to mediate the clearance and degradation of A-beta, the major component of beta-amyloid deposits.
Product Categories/Family for anti-A2M antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
161kDa
NCBI Official Full Name
alpha-2-macroglobulin isoform a
NCBI Official Synonym Full Names
alpha-2-macroglobulin
NCBI Official Symbol
A2M
NCBI Official Synonym Symbols
A2MD; CPAMD5; FWP007; S863-7
NCBI Protein Information
alpha-2-macroglobulin
UniProt Protein Name
Alpha-2-macroglobulin
UniProt Gene Name
A2M
UniProt Synonym Gene Names
CPAMD5; Alpha-2-M
UniProt Entry Name
A2MG_HUMAN
Similar Products
Product Notes
The A2M a2m (Catalog #AAA200912) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The A2M antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's A2M can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the A2M a2m for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PVPGHVTVSI CRKYSDASDC HGEDSQAFCE KFSGQLNSHG CFYQQVKTKV. It is sometimes possible for the material contained within the vial of "A2M, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.