Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199513_WB13.jpg WB (Western Blot) (WB Suggested Anti-AADAC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Rabbit AADAC Polyclonal Antibody | anti-AADAC antibody

AADAC antibody - N-terminal region

Gene Names
AADAC; DAC; CES5A1
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AADAC, Antibody; AADAC antibody - N-terminal region; anti-AADAC antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFN
Sequence Length
399
Applicable Applications for anti-AADAC antibody
WB (Western Blot)
Homology
Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 91%; Rabbit: 100%; Rat: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human AADAC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-AADAC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

product-image-AAA199513_WB13.jpg WB (Western Blot) (WB Suggested Anti-AADAC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

WB (Western Blot)

(Host: RabbitTarget Name: AADACSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA199513_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: AADACSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-AADAC antibody
This is a rabbit polyclonal antibody against AADAC. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-5 AV705031.1 1-5 6-247 L32179.1 1-242 248-1725 BC032309.1 183-1660
Product Categories/Family for anti-AADAC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
13
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
arylacetamide deacetylase
NCBI Official Synonym Full Names
arylacetamide deacetylase
NCBI Official Symbol
AADAC
NCBI Official Synonym Symbols
DAC; CES5A1
NCBI Protein Information
arylacetamide deacetylase
UniProt Protein Name
Arylacetamide deacetylase
UniProt Gene Name
AADAC
UniProt Synonym Gene Names
DAC
UniProt Entry Name
AAAD_HUMAN

Similar Products

Product Notes

The AADAC aadac (Catalog #AAA199513) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AADAC antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AADAC can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the AADAC aadac for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AHLKTIQNLA TFVELLGLHH FMDSFKVVGS FDEVPPTSDE NVTVTETKFN. It is sometimes possible for the material contained within the vial of "AADAC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.